PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G16580.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family ARF
Protein Properties Length: 611aa    MW: 67909.7 Da    PI: 6.8236
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G16580.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.26.5e-181191813498
                      SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
               B3  34 ktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      ++l+ +d++g++W +++i+r++++r++lt+GW+ Fv++++L +gD ++F   + +++el+v+v+r
  LPERR02G16580.2 119 QELVARDLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFL--RGENGELRVGVRR 181
                      37999*********************************************..449999*****97 PP

2Auxin_resp111.86.8e-37207289183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha+st++ F+v+Y+Pr+s+seFvv+v+k+++a ++k+svGmRfkm+fe+++++err+sGt++gv  ++++ W nS WrsLk
  LPERR02G16580.2 207 ASHAISTGTLFSVFYKPRTSQSEFVVSVNKYLEAKNSKISVGMRFKMRFEGDEAPERRFSGTIIGVGSMSTSPWANSDWRSLK 289
                      789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010198.1E-8100183IPR003340B3 DNA binding domain
SuperFamilySSF1019361.96E-25107210IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.9E-26111196IPR015300DNA-binding pseudobarrel domain
PfamPF023622.4E-15118181IPR003340B3 DNA binding domain
CDDcd100176.95E-15119181No hitNo description
PROSITE profilePS5086310.955120183IPR003340B3 DNA binding domain
PfamPF065071.2E-34207289IPR010525Auxin response factor
PfamPF023092.0E-13461571IPR033389AUX/IAA domain
PROSITE profilePS5174526.092481574IPR000270PB1 domain
SuperFamilySSF542778.34E-13483560No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 611 aa     Download sequence    Send to blast
MMVGSGAAAA AAGGGGGGGS GSSCDALYRE LWNACAGTLV TVPRQGELVY YFPQGHMEQL  60
EASTDQQLDQ HLPLFNLPSK ILCKVVNVEL RAETDSDEVY AQIMLHPESD DMTQNPPWQE  120
LVARDLHGNE WHFRHIFRGQ PRRHLLTTGW SVFVSSKRLV AGDAFIFLRG ENGELRVGVR  180
RLMRQLNNMP SSVISSHSMH LGVLATASHA ISTGTLFSVF YKPRTSQSEF VVSVNKYLEA  240
KNSKISVGMR FKMRFEGDEA PERRFSGTII GVGSMSTSPW ANSDWRSLKI EFHHGNWSHL  300
PRVIRSHRLS LLQEINELGL LLRIQLPQNS LRSLVCGNLQ PSPHKRTHEL YPSSPNPIFS  360
TPLNVGFNTK NEPSALTNKH FYWPMRETRA DSYSASINKV PSEKKQEPSS AGCRLFGIEI  420
SSAVEATSPV PAVSVVGQEQ PAASVDAESD QLSQPSQANK SDAPAASSEP SPHETQSRQV  480
RSCTKVIMQG MAVGRAVDLT RLHGYDDLRH KLEEMFDIQG ELSASLKKWK VVYTDDEDDM  540
MLVGDDPWHE FCSMVKRIYI YTYEEAKQLI PKSKLPIIGD TIKPNPNKQS PESDMPHSDL  600
DNTAPVTDKD C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-147103102348Auxin response factor 1
4ldw_A1e-147103102348Auxin response factor 1
4ldv_A1e-147103102348Auxin response factor 1
4ldx_B1e-147103102348Auxin response factor 1
4ldx_A1e-147103102348Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0700260.0AK070026.1 Oryza sativa Japonica Group cDNA clone:J023036G16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625501.10.0PREDICTED: auxin response factor 7
SwissprotQ6YVY00.0ARFG_ORYSJ; Auxin response factor 7
TrEMBLA0A0D9VH390.0A0A0D9VH39_9ORYZ; Auxin response factor
STRINGORGLA02G0176700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108236116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1