PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G16580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family ARF
Protein Properties Length: 582aa    MW: 65493.1 Da    PI: 7.2185
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G16580.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.36e-18901523498
                      SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
               B3  34 ktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      ++l+ +d++g++W +++i+r++++r++lt+GW+ Fv++++L +gD ++F   + +++el+v+v+r
  LPERR02G16580.1  90 QELVARDLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFL--RGENGELRVGVRR 152
                      37999*********************************************..449999*****97 PP

2Auxin_resp111.96.3e-37178260183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha+st++ F+v+Y+Pr+s+seFvv+v+k+++a ++k+svGmRfkm+fe+++++err+sGt++gv  ++++ W nS WrsLk
  LPERR02G16580.1 178 ASHAISTGTLFSVFYKPRTSQSEFVVSVNKYLEAKNSKISVGMRFKMRFEGDEAPERRFSGTIIGVGSMSTSPWANSDWRSLK 260
                      789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010198.1E-871154IPR003340B3 DNA binding domain
SuperFamilySSF1019361.83E-2578181IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.5E-2682167IPR015300DNA-binding pseudobarrel domain
PfamPF023622.3E-1589152IPR003340B3 DNA binding domain
CDDcd100176.30E-1590152No hitNo description
PROSITE profilePS5086310.95591154IPR003340B3 DNA binding domain
PfamPF065071.1E-34178260IPR010525Auxin response factor
PfamPF023091.5E-13431542IPR033389AUX/IAA domain
PROSITE profilePS5174526.092452545IPR000270PB1 domain
SuperFamilySSF542777.85E-13454531No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MLCTGNYGML VLERWSQYLA KANWSTTSPK LEASTDQQLD QHLPLFNLPS KILCKVVNVE  60
LRAETDSDEV YAQIMLHPES DDMTQNPPWQ ELVARDLHGN EWHFRHIFRG QPRRHLLTTG  120
WSVFVSSKRL VAGDAFIFLR GENGELRVGV RRLMRQLNNM PSSVISSHSM HLGVLATASH  180
AISTGTLFSV FYKPRTSQSE FVVSVNKYLE AKNSKISVGM RFKMRFEGDE APERRFSGTI  240
IGVGSMSTSP WANSDWRSLK IEFHHGNWSH LPRVIRSHRL SLLQEINELG LLLRIQLPQN  300
SLRSLVCGNL QPSPHKRTHE LYPSSPNPIF STPLNVGFNT KNEPSALTNK HFYWPMRETR  360
ADSYSASINK VPSEKKQEPS SAGCRLFGIE ISSAVEATSP VPAVSVVGQE QPAASVDAES  420
DQLSQPSQAN KSDAPAASSE PSPHETQSRQ VRSCTKVIMQ GMAVGRAVDL TRLHGYDDLR  480
HKLEEMFDIQ GELSASLKKW KVVYTDDEDD MMLVGDDPWH EFCSMVKRIY IYTYEEAKQL  540
IPKSKLPIIG DTIKPNPNKQ SPESDMPHSD LDNTAPVTDK DC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1213028151348Auxin response factor 1
4ldw_A1e-1213028151348Auxin response factor 1
4ldw_B1e-1213028151348Auxin response factor 1
4ldx_A1e-1213028151348Auxin response factor 1
4ldx_B1e-1213028151348Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0700260.0AK070026.1 Oryza sativa Japonica Group cDNA clone:J023036G16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625501.10.0PREDICTED: auxin response factor 7
SwissprotQ6YVY00.0ARFG_ORYSJ; Auxin response factor 7
TrEMBLA0A0D9VH380.0A0A0D9VH38_9ORYZ; Auxin response factor
STRINGLOC_Os02g35140.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.41e-178auxin response factor 1