PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G05150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family CO-like
Protein Properties Length: 211aa    MW: 22635.8 Da    PI: 8.161
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G05150.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.91.7e-075398342
         zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                      ++C+ +e  ++   C+ +   lC+ C   +H +      H++vp+
  LPERR02G05150.1 53 VWVCEVCEISPAAVTCKADAAALCAACDADIHPSdvlarrHERVPV 98
                     689******99*********************66777778999986 PP

2CCT70.63.9e-24151194144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      R+a+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpRvKGrF+k+a
  LPERR02G05150.1 151 RAARLMRYREKRKNRRFEKTIRYASRKAYAETRPRVKGRFAKRA 194
                      99****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0781155IPR000315B-box-type zinc finger
PROSITE profilePS5011910.5525198IPR000315B-box-type zinc finger
PfamPF006431.6E-55298IPR000315B-box-type zinc finger
SMARTSM003362.3E-55698IPR000315B-box-type zinc finger
PfamPF062034.6E-18151193IPR010402CCT domain
PROSITE profilePS5101716.807151193IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MELGLGRYWG VGGRRCGACA VAPAAVHCRT CGGGEYLCAG CDADHARAGH ERVWVCEVCE  60
ISPAAVTCKA DAAALCAACD ADIHPSDVLA RRHERVPVQP IGSDATDADM LLLGGEKDSS  120
AAGDDLAGGC GKEVKLMYFG ESHVSSMDVG RAARLMRYRE KRKNRRFEKT IRYASRKAYA  180
ETRPRVKGRF AKRADDAAPP ERVMLDFAAG S
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR02G05150.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0048382e-71AP004838.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0504A05.
GenBankAP0149582e-71AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126102e-71CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623284.18e-49zinc finger protein CONSTANS-LIKE 3
SwissprotQ9FHH83e-29COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A0D9VCW31e-149A0A0D9VCW3_9ORYZ; Uncharacterized protein
STRINGLPERR02G05150.11e-150(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.12e-21CONSTANS-like 5
Publications ? help Back to Top
  1. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]