PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G34430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family LBD
Protein Properties Length: 255aa    MW: 26319.6 Da    PI: 8.0505
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G34430.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601376.8e-4332130199
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+v++i+ lq++l+ql+++l
  LPERR01G34430.1  32 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPYQREDAVNSLAYEADMRLRDPVYGCVAIISILQRNLRQLQQDL 125
                      7********************************************************************************************* PP

           DUF260  95 allke 99 
                      a++k 
  LPERR01G34430.1 126 ARAKF 130
                      99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.33231132IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4232128IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MASSSASSVP APSGSVITIA SAAAATCGTG SPCAACKFLR RKCQPDCVFA PYFPPDNPQK  60
FVHVHRVFGA SNVTKLLNEL HPYQREDAVN SLAYEADMRL RDPVYGCVAI ISILQRNLRQ  120
LQQDLARAKF ELSKYQVAAA AANNGMAEFI GNAVPNGQSF INVGHTAALA SIGGSAACFG  180
QEQFSTVQML SAARSYEGEP IARLGGNGGY EFGYSTAAMA GGGAGHMSGL GTLGGGPFLK  240
SGIAGSDETR SGAGQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF5407661e-150EF540766.1 Oryza sativa Japonica Group LOB domain protein 6 mRNA, complete cds.
GenBankAB2002371e-150AB200237.1 Oryza sativa Japonica Group CRLL3 mRNA for LOB domain protein, complete cds.
GenBankAK1195751e-150AK119575.1 Oryza sativa Japonica Group cDNA clone:002-117-B04, full insert sequence.
GenBankAK0714071e-150AK071407.1 Oryza sativa Japonica Group cDNA clone:J023089G14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634701.11e-141PREDICTED: LOB domain-containing protein 6
SwissprotA2WXT01e-143LBD6_ORYSI; LOB domain-containing protein 6
SwissprotQ8LQH41e-143LBD6_ORYSJ; LOB domain-containing protein 6
TrEMBLA0A0D9V8S90.0A0A0D9V8S9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA004955-PA1e-141(Oryza sativa Indica Group)
STRINGLOC_Os01g66590.11e-141(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.42e-50LBD family protein