PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G34330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family NAC
Protein Properties Length: 420aa    MW: 45118.3 Da    PI: 9.0732
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G34330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.37.6e-50471722128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                      +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + ++
  LPERR01G34330.1  47 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRAE 139
                      79***************************.89***************888889***************************************** PP

              NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +glkktLvfy+g+apkg++++W+m+eyrl
  LPERR01G34330.1 140 NNRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 172
                      *******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-5546192IPR003441NAC domain
PROSITE profilePS5100555.24646193IPR003441NAC domain
PfamPF023651.5E-2448172IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MPVRRRGDEL AATAVMSNNN AAAAAGGGGG GSKEEAAGDG HEDDLVMPGF RFHPTEEELI  60
EFYLRRKVEG KRFNVELITF LDLYRYDPWE LPAMAAIGEK EWFFYVPRDR KYRNGDRPNR  120
VTASGYWKAT GADRMIRAEN NRPIGLKKTL VFYSGKAPKG VRSSWIMNEY RLPPADTDRY  180
HKTEISLCRV YKRTGIDDGH GHTISSTARS TTTHSRSGGA AAARTQDNKQ GSSSTSTPTP  240
PPTPSKLHLL TGECTSPPAT IMSHKQQQQV PSSMASVAGG DHHQHDVTAA LYHQYAAGGG  300
GGGSKNTISG GGAFASTTTY SLLSLVNAAS SMGSTTAAAV AIDELSSLVG HGTTPSYLNS  360
SVISQAPYSH HQFLPLLPTT PPPSHPTAPM SLAAIADKIW DWNPIPDQAG VRDYSTAGFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-534819319165NO APICAL MERISTEM PROTEIN
1ut4_B1e-534819319165NO APICAL MERISTEM PROTEIN
1ut7_A1e-534819319165NO APICAL MERISTEM PROTEIN
1ut7_B1e-534819319165NO APICAL MERISTEM PROTEIN
4dul_A1e-534819319165NAC domain-containing protein 19
4dul_B1e-534819319165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR01G34330.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1029020.0AK102902.1 Oryza sativa Japonica Group cDNA clone:J033113D13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695832.11e-173PREDICTED: NAC transcription factor ONAC010
TrEMBLA0A0D9V8R60.0A0A0D9V8R6_9ORYZ; Uncharacterized protein
STRINGLPERR01G34330.20.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-101NAC domain containing protein 35