PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G33060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 266aa    MW: 27878.7 Da    PI: 9.112
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G33060.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.34.4e-15182234355
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+eN ++ ke ee  ++
  LPERR01G33060.1 182 AMQRQKRMIKNRESAARSRERKQAYIAELESLVMQLEEENAKMFKEQEEQHQK 234
                      689*************************************9998877665444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.2E-9180244IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.783182246IPR004827Basic-leucine zipper domain
PfamPF001704.6E-14182241IPR004827Basic-leucine zipper domain
CDDcd147076.00E-21184234No hitNo description
SuperFamilySSF579591.76E-10184233No hitNo description
Gene3DG3DSA:1.20.5.1707.6E-13185242No hitNo description
PROSITE patternPS000360187202IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MASSRVMASS SPSHTTSDLA RFAAGRGGST GLGSMNVEEI LRGIYADMPT PSLAPVVDGG  60
RPMSPPPAPG IAAAAAAPRT AEEVWKEITG GVGVAAAAPD VVAAGGGGGA GGGAGAAEMT  120
LEDFLAREGG AVKEDVVAGP SASAVEGQVV MGFLNGAEVA GGVTGGGRSR KRQLMDPMDR  180
AAMQRQKRMI KNRESAARSR ERKQAYIAEL ESLVMQLEEE NAKMFKEQEE QHQKRLKELK  240
EMITPVVVRK MPSRDLRRTN SMQWCS
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR01G33060.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0679191e-139AK067919.1 Oryza sativa Japonica Group cDNA clone:J013123H12, full insert sequence.
GenBankGQ9042381e-139GQ904238.1 Oryza sativa Japonica Group ABA responsive element binding factor 1 mRNA, complete cds.
GenBankOSU252831e-139U25283.1 Oryza sativa clone OSE2 leucine zipper protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612904.11e-113bZIP transcription factor 12-like
SwissprotQ0JHF11e-115BZP12_ORYSJ; bZIP transcription factor 12
TrEMBLA0A0D9V8760.0A0A0D9V876_9ORYZ; Uncharacterized protein
STRINGLPERR01G33060.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.13e-29G-box binding factor 4
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]