PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G32620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 393aa    MW: 42171.7 Da    PI: 6.0918
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G32620.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.22e-14309354550
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                      +r+rr++kNRe+A rsR+RK+a++ eLe + + L++eN +L++  +
  LPERR01G32620.1 309 RRQRRMIKNRESAARSRARKQAYTVELEAELDYLKQENARLRDAEK 354
                      79***************************************96544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.2E-13305370IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.68307350IPR004827Basic-leucine zipper domain
CDDcd147072.10E-23309363No hitNo description
Gene3DG3DSA:1.20.5.1709.6E-14309352No hitNo description
SuperFamilySSF579591.19E-10309353No hitNo description
PfamPF001706.8E-12309355IPR004827Basic-leucine zipper domain
PROSITE patternPS000360312327IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010152Biological Processpollen maturation
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MASEMGKNAK VADDQEVTSQ ERDQSGGTKV DGEDQVASLA RQSSILSLTL EELQNSFCEP  60
GRNFGSMNMD EFVANIWNAE EFQAATGGCK GAMEETKVVG VGSEGGDAGG SGLCRQGSFS  120
LPLPLCQKTV EEVWAEINQG PAHTSAEVPA QQLVQPRAGS GGIAADGRRV TLGEMTLEDF  180
LVKAGVVRGS FTGQGRTTMG AGMIHGPVNP MQQGQAGPMM FPVGPANAMY PVMGDGMGYP  240
NGYNGMAVVP PPPPSHGAMA AVSPGSSDGM SAMTHADMMN CIGNGMVIEN GTRKRPHRED  300
GSLEKTVERR QRRMIKNRES AARSRARKQA YTVELEAELD YLKQENARLR DAEKTILLTK  360
KQMLVEKMMA ESKERMNAKE GSSRLRRTGS CMW
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that possesses transactivation activity in yeast (PubMed:17604002, PubMed:21055780, PubMed:18236009). Involved in abscisic acid (ABA) signaling pathway. Binds to the G-box motif 5'-CACGTG-3' of TRAB1 gene promoter (PubMed:17604002). Involved in the regulation of pollen maturation. May act as negative regulator of salt stress response (PubMed:18236009). Together with PYL5, PP2C30 and SAPK2, is part of an ABA signaling unit that modulates seed germination and early seedling growth (PubMed:22071266). {ECO:0000269|PubMed:17604002, ECO:0000269|PubMed:18236009, ECO:0000269|PubMed:21055780, ECO:0000269|PubMed:22071266}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR01G32620.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) (PubMed:21055780, PubMed:18236009, PubMed:22071266). Induced by salt stress. Down-regulated by cold and drought stresses (PubMed:18236009). {ECO:0000269|PubMed:18236009, ECO:0000269|PubMed:21055780, ECO:0000269|PubMed:22071266}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628684.10.0bZIP transcription factor ABI5 homolog
SwissprotQ8RZ350.0ABI5_ORYSJ; bZIP transcription factor ABI5 homolog
TrEMBLA0A0D9V8130.0A0A0D9V813_9ORYZ; Uncharacterized protein
STRINGLPERR01G32620.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38303558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.11e-45bZIP family protein
Publications ? help Back to Top
  1. Zou M,Guan Y,Ren H,Zhang F,Chen F
    A bZIP transcription factor, OsABI5, is involved in rice fertility and stress tolerance.
    Plant Mol. Biol., 2008. 66(6): p. 675-83
    [PMID:18236009]
  2. Kim H, et al.
    A rice orthologue of the ABA receptor, OsPYL/RCAR5, is a positive regulator of the ABA signal transduction pathway in seed germination and early seedling growth.
    J. Exp. Bot., 2012. 63(2): p. 1013-24
    [PMID:22071266]
  3. Bhatnagar N, et al.
    The protein phosphatase 2C clade A protein OsPP2C51 positively regulates seed germination by directly inactivating OsbZIP10.
    Plant Mol. Biol., 2017. 93(4-5): p. 389-401
    [PMID:28000033]