PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G30700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family LBD
Protein Properties Length: 397aa    MW: 42718.6 Da    PI: 8.1444
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G30700.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.33.5e-402023011100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++C++apyf  ++p+kfa+vhk+FGasnv+k+l ++ e er da+sslvyeA+ r+rdPvyG++g i+ lqqq++ l+ael
  LPERR01G30700.1 202 PCAACKLLRRRCAQECPFAPYFSPHEPHKFAAVHKVFGASNVSKMLLEVGEAERADAASSLVYEANLRLRDPVYGCMGAISMLQQQVNALEAEL 295
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++++e
  LPERR01G30700.1 296 EAVRAE 301
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.171201302IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-40202299IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MSRNTRRNTR GGLQAQEGQA NKSSQPFNTR QHFFPSCPFT CYQLYKLPIP LITPLPFKHS  60
FLPCNSKLYT SIPSSPLSSG RSYLNLLLSF CSCCASPSHH ISQAQEYASM STESSWLKIQ  120
ILHCGLHLDH LPIPCPQKTL NSNLAFSTSA RERHDEIGKK IKREPDSAGV LIAAATTTAA  180
PIEHRIVPHR VVLGGAVNTV TPCAACKLLR RRCAQECPFA PYFSPHEPHK FAAVHKVFGA  240
SNVSKMLLEV GEAERADAAS SLVYEANLRL RDPVYGCMGA ISMLQQQVNA LEAELEAVRA  300
EIFKHRYRQA GVAGAAGLMV DDVHGTAAGF VAPAHPPPMH SSDVVSVVEA AGGQELAGAV  360
APVISSASPP VYADGQPSSS GTDYSSLNTS EHTAYFG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1219190.0AK121919.1 Oryza sativa Japonica Group cDNA clone:J033106D14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644931.11e-126PREDICTED: LOB domain-containing protein 15 isoform X1
RefseqXP_015636038.11e-126PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T54e-66LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A0D9V7A80.0A0A0D9V7A8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA004719-PA1e-126(Oryza sativa Indica Group)
STRINGLOC_Os01g60960.11e-126(Oryza sativa Japonica Group)
STRINGOB01G44400.11e-126(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-63LOB domain-containing protein 15