PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G30010.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 330aa    MW: 35627 Da    PI: 10.2337
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G30010.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.91.4e-15260305551
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                      +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN +Lk   +e
  LPERR01G30010.2 260 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENVRLKR-QKE 305
                      69***************************************94.344 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-11256328IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.323258303IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.1E-14260308No hitNo description
SuperFamilySSF579593.75E-11260305No hitNo description
CDDcd147073.43E-24260307No hitNo description
PfamPF001707.2E-13260303IPR004827Basic-leucine zipper domain
PROSITE patternPS000360263278IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MASNTGGAAA QRGRMPSLGR QGSLYSLTLD EVQSHLGEPL HSMNLDELLR SVFPDGVAAA  60
GGGGIQRREQ SSGLSRQGSI AMPPELSKKT VDEVWKGIQA APKRRNGAET GGRRRRQRQP  120
TLGEVTLEDF LVKAGVVTQG SLKEMGDGDA SGNVDPVGRG VAVAGTADLA SGAQWIERYK  180
QQIAATADVH QHGQQSVQGV YMTNRLVPQP VNVGPGAVLE PSYSDGQASS GMIGGISDSQ  240
TPGRKRGMFS GDVADKLIER RQKRMIKNRE SAARSRARKQ AYTNELENKV SRLEEENVRL  300
KRQKELDEIL CAVPVPEPKY QLRRTSSADF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111118GRRRRQRQ
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR01G30010.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627754.11e-177ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES33e-84AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A0D9V7080.0A0A0D9V708_9ORYZ; Uncharacterized protein
STRINGLPERR01G30010.10.0(Leersia perrieri)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.15e-83ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]
  2. Song C,Kim T,Chung WS,Lim CO
    The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions.
    Mol. Cells, 2017. 40(8): p. 577-586
    [PMID:28756655]