PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G26810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family ARF
Protein Properties Length: 709aa    MW: 77667.3 Da    PI: 7.5304
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G26810.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3795e-25191292199
                      EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      f+k+lt sd++++g +++p++ ae++       ++    s++l+ +d++g +W++++iyr++++r++lt+GW++Fv+ ++L +gD v+F   + 
  LPERR01G26810.1 191 FCKTLTASDTSTHGGFSVPRRAAEDCfppldhkQLR--PSQELVAKDLHGAKWKFRHIYRGQPRRHLLTTGWSSFVNKKKLVSGDAVLFL--RG 280
                      99**************************99865444..4669************************************************..34 PP

                      SEE..EEEEE-S CS
               B3  88 sefelvvkvfrk 99 
                      +++el+++v+r+
  LPERR01G26810.1 281 DDGELRLGVRRA 292
                      89999****997 PP

2Auxin_resp1163.3e-38317397182
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                      +a++++++svF+++YnPra++seFvv+++k++k+++++v+vGmRfk++fe+ed++err +G+++gvs+ldp+rWp+SkWrsL
  LPERR01G26810.1 317 VADSLKHGSVFHICYNPRATASEFVVPYWKFVKSFNHPVCVGMRFKFQFESEDVNERR-AGIIAGVSELDPIRWPGSKWRSL 397
                      578899****************************************************.9********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.7E-46175330IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.2E-38189293IPR015300DNA-binding pseudobarrel domain
CDDcd100171.61E-22189291No hitNo description
PfamPF023625.6E-23191292IPR003340B3 DNA binding domain
PROSITE profilePS5086313.549191293IPR003340B3 DNA binding domain
SMARTSM010191.7E-24191293IPR003340B3 DNA binding domain
PfamPF065071.3E-31318397IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 709 aa     Download sequence    Send to blast
MASASSSSTS SRPPLMVLPS FYHRPPWPSE RGGGEHRSDC WAGSPVGGGR ARAAMGIDLN  60
NTASGGGGEE DDAPPAPVVC RELWHACAGP VVSLPRRGCK VVYLPQGHLA AAGAGGGIRG  120
EVAVALPPHV ACRVVDVELC ADAATDEVYA RLALVAEGEV FERNFHGGGI EKEDDMEDGD  180
DERKSGMLHM FCKTLTASDT STHGGFSVPR RAAEDCFPPL DHKQLRPSQE LVAKDLHGAK  240
WKFRHIYRGQ PRRHLLTTGW SSFVNKKKLV SGDAVLFLRG DDGELRLGVR RATPLKNEAI  300
FKAFNTESSK MRTLSAVADS LKHGSVFHIC YNPRATASEF VVPYWKFVKS FNHPVCVGMR  360
FKFQFESEDV NERRAGIIAG VSELDPIRWP GSKWRSLLVR WEDTTDCNSQ SRVSPWEIEI  420
VDGSVSVAHS LSTSNGNGRP DSVETEKFPR VLQGQELMGS RTHPVTCSPQ SIDVTKSKCF  480
DAWRFLTDTR SCMFSSSTSR LPVQYSGFSH QSVGFSESIG FPEVLQGQEI SQTVPQFQGM  540
VPDACSAKSR YELQNYMCTS ATMTGLSAAN QGYCLSLSTV PPSAPSSLMS YQTSVPQLEL  600
ASKNNDKSVS QHSETSWEQF KIGKASVPGH SAKPVHGGRD VGRTSCRLFG FSLTEKVIPT  660
TEKDGEKEGN YETDCQNPRM LDLFGYNCTT PGRDRYIWRH IHSAPHPQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-101604225356Auxin response factor 1
4ldy_B1e-101604225356Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0723300.0AK072330.1 Oryza sativa Japonica Group cDNA clone:J023039P13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634503.10.0PREDICTED: auxin response factor 3 isoform X1
SwissprotQ5JMM10.0ARFC_ORYSJ; Auxin response factor 3
TrEMBLA0A0D9V5S00.0A0A0D9V5S0_9ORYZ; Auxin response factor
STRINGLOC_Os01g54990.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51132756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-144ARF family protein