PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G22260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family ARF
Protein Properties Length: 718aa    MW: 78695.6 Da    PI: 7.3274
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G22260.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.36.9e-24147248199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++p++ ae++      +++ + s++l+ +d++g +W++++iyr++++r++lt+GW++F + ++L +gD v+F   + +
  LPERR01G22260.1 147 FCKTLTASDTSTHGGFSVPRRAAEDCfppldySLQRP-SQELVAKDLHGTEWRFRHIYRGQPRRHLLTTGWSGFINKKKLVSGDAVLFL--RGE 237
                      99****************************9966654.569************************************************..449 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      ++el+++v+r+
  LPERR01G22260.1 238 DGELRLGVRRA 248
                      999*****996 PP

2Auxin_resp105.46.7e-35273353182
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                      +a+a++ ks+F+++YnPr s+seF+++++k+++++++++svGmRfk+++e+ed+serr +G+++g ++++p  W++SkW++L
  LPERR01G22260.1 273 VARAVAVKSIFHIYYNPRLSHSEFIIPYWKFMRSFNQPFSVGMRFKLRYESEDASERRRTGIIIGSREAEP-IWHGSKWKCL 353
                      678999*****************************************************************.8********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.4E-39140251IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.49E-43142275IPR015300DNA-binding pseudobarrel domain
CDDcd100176.94E-22145247No hitNo description
PROSITE profilePS5086313.281147249IPR003340B3 DNA binding domain
PfamPF023627.2E-22147248IPR003340B3 DNA binding domain
SMARTSM010191.4E-22147249IPR003340B3 DNA binding domain
PfamPF065078.6E-29274353IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 718 aa     Download sequence    Send to blast
MVGIDLNTVE EEEEEEEEGC TGAALARAAG GGGVCLELWH ACAGPVAPLP RKGSVVVYLP  60
QGHLEHLGAA ASSGAAAAAV PPHVFCRVVD VSLHADAATD EVYAQVSLVA DNEAVERRMR  120
ERDDGAAGDC EGEDAAVKRP ARIPHMFCKT LTASDTSTHG GFSVPRRAAE DCFPPLDYSL  180
QRPSQELVAK DLHGTEWRFR HIYRGQPRRH LLTTGWSGFI NKKKLVSGDA VLFLRGEDGE  240
LRLGVRRAAQ LKNVSPFPAL HNQSSNASSL SEVARAVAVK SIFHIYYNPR LSHSEFIIPY  300
WKFMRSFNQP FSVGMRFKLR YESEDASERR RTGIIIGSRE AEPIWHGSKW KCLVVKWDDD  360
VECRWPNGVS PWEIELSGSI SGSHLSTPNS KRLKPCFPQV NPDIVLPNGS VSSDFAESAR  420
FHKVLQCQEL FGLKTRDGTV NTASQVTEAR KFQYPDERSC FISMGNNFSG VPKLGVKTPS  480
RNLGFSYHCS GFGESQRFQE VLQGQEVFRP YRGGTLSDAC IRGSGFRQPD GNHASGAAFK  540
WLAPQGCDHH GITTPVLPQA SSPSSVLMFP QTSSKMPGLE YIYGCMDRNE SSQHFKTGPT  600
QDMARADQTL RLWPHLISGK VLDECKGNEK LHSPVSGAEH ESNNSCLNTN GCKIFGISLT  660
EKVQAGDEVD CANASYHSRL QSLKPQMPKS LGSSCATVHE QRAVVGRVVD ISAVNTMI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-1103338318361Auxin response factor 1
4ldy_B1e-1103338318361Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0712910.0AB071291.1 Oryza sativa OsETTIN2 mRNA for Arabidopsis ETTIN-like protein 2, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647511.10.0PREDICTED: auxin response factor 2 isoform X2
SwissprotQ0JKI90.0ARFB_ORYSJ; Auxin response factor 2
TrEMBLA0A0D9V3Z20.0A0A0D9V3Z2_9ORYZ; Auxin response factor
STRINGLOC_Os01g48060.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25373580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-163ARF family protein