PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G04660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family G2-like
Protein Properties Length: 519aa    MW: 53713.3 Da    PI: 6.0297
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G04660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.21.4e-31282337156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+peLH+rFv+a++ LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  LPERR01G04660.1 282 KARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 337
                      68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-17279340IPR009057Homeodomain-like
PROSITE profilePS5129413.69279339IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-28280340IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-26282337IPR006447Myb domain, plants
PfamPF002491.1E-6284335IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MASSSSDLTL DYKPNGDCGG GGGAYPKQSP AAAAAIAVDH GQATQKLQEF LSRLEEERLK  60
IDAFKRELPL CMQLLNHAME AYRQQLEAYQ MGSQSAAAAR PLVLEEFIPL KNIGIDVTAA  120
AAEKAAAASE KASWMVSAQL WNAPANGAAA AKGPETPKEH SEQQHHPLAV DSSPRLIAAL  180
DAGGGGVGGG AFLPFSKEIN GGAMAGDVGS NAAALPELAL APAEKVDAIA VAGEGEKKPY  240
AHDNNGVAVA RSQNGGKTSS SSAPDGHAVG PPPASAPQTH RKARRCWSPE LHRRFVNALQ  300
ILGGAQVATP KQIRELMKVD GLTNDEVKSH LQKYRLHTRR PMAAAPAATA AAPQLVVLGG  360
IWVPPEYATQ AAGPAIYGAH PATPQPHYTA VAAHEYYHHH HHHQSPSAAA AVHHLQHHPA  420
AAALVHHRAV AAAPPPPQPV APAYSSKSPD SDGRGSGGGG GGRDRSESID EEGQGDQERE  480
DDDDDDEMAA ATAANDGAGA DDDDDEINAA TTSAGGINY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-13282335154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13282335154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13282335154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13282335154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in regulatory networks controlling development and metabolism. {ECO:0000250|UniProtKB:Q6Z869}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR01G04660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1098081e-122AK109808.1 Oryza sativa Japonica Group cDNA clone:002-147-G07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631343.11e-160transcription factor NIGTH1-like isoform X1
SwissprotQ5VRW21e-161NOH1_ORYSJ; Transcription factor NIGTH1
TrEMBLA0A0D9UXF70.0A0A0D9UXF7_9ORYZ; Uncharacterized protein
STRINGLPERR01G04660.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-78G2-like family protein
Publications ? help Back to Top
  1. Kamrul Huda KM, et al.
    Salinity and drought tolerant OsACA6 enhances cold tolerance in transgenic tobacco by interacting with stress-inducible proteins.
    Plant Physiol. Biochem., 2014. 82: p. 229-38
    [PMID:24992889]