PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G04140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family LBD
Protein Properties Length: 281aa    MW: 29180 Da    PI: 7.8144
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G04140.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.43e-44301291100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk+FGasnv+kll++l +++reda+ssl+yeAear++dPvyG+vg i+ lq+q+++l++el
  LPERR01G04140.1  30 PCAACKFLRRKCLPGCVFAPYFPPEEPQKFANVHKVFGASNVTKLLNELLPHQREDAVSSLAYEAEARVKDPVYGCVGAISVLQRQVHRLQKEL 123
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++++e
  LPERR01G04140.1 124 DAAHAE 129
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.50329130IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-4330127IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MASSSSTSNS AMSPVVSSPA AATAPGAGSP CAACKFLRRK CLPGCVFAPY FPPEEPQKFA  60
NVHKVFGASN VTKLLNELLP HQREDAVSSL AYEAEARVKD PVYGCVGAIS VLQRQVHRLQ  120
KELDAAHAEL LRYACGETGI PTALPVVTAA APRLAAAAMP APGHSHAHAH QLAAVTAGMY  180
GGGRRLGVID GGGDRIAHTA GCYYARSNSA ADVAPVLPYA SMANWTVNAI STTTTNSGSE  240
SIGMVDHKEG GDSSIGSITE ICALASMRRL QEDGQPIHPR H
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0033390.0AP003339.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OJ1276_B06.
GenBankAP0029120.0AP002912.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0028E10.
GenBankAB2002380.0AB200238.1 Oryza sativa Japonica Group CRLL4 mRNA for LOB domain protein, complete cds.
GenBankAK1055270.0AK105527.1 Oryza sativa Japonica Group cDNA clone:001-127-G05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648013.11e-142PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_015648006.11e-142PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_015648000.11e-142PREDICTED: protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A0D9UX880.0A0A0D9UX88_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g07480.11e-142(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88133545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.45e-63LBD family protein