PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v2006670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HB-other
Protein Properties Length: 605aa    MW: 69120.3 Da    PI: 6.9756
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v2006670.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.4e-194095257
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                      kR+  t+ qle Le+++++++yps++ r eL++klgLt+rq ++WF+ rR k+kk
  Lj6g3v2006670.1 40 PKRQMKTPFQLENLEKAYASEMYPSEAVRVELSEKLGLTDRQLQMWFCHRRLKDKK 95
                     69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-192195IPR009057Homeodomain-like
SuperFamilySSF466891.15E-162795IPR009057Homeodomain-like
PROSITE profilePS5007116.4873696IPR001356Homeobox domain
SMARTSM003891.2E-1738100IPR001356Homeobox domain
PfamPF000461.2E-164095IPR001356Homeobox domain
CDDcd000868.99E-124190No hitNo description
PROSITE profilePS5082712.115567605IPR018501DDT domain
PfamPF027912.7E-9569602IPR018501DDT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MKDEAASDGD DNNDTQKRDD DGGGGDNSKL GNSSEGQSKP KRQMKTPFQL ENLEKAYASE  60
MYPSEAVRVE LSEKLGLTDR QLQMWFCHRR LKDKKDLPPK KPLKAPPLLA SPTDDLRLGS  120
EPGNDYGSGS GSGSSPPSRS ELRNAVPVRA VPGYYESPQT IMELRAIACV EAQLGEPLRE  180
DGPILGVEFD PLPPDAFGAP IAVAEQQKRP NLAYDSKIYD RHDVRTNKAP FQAMARTFPE  240
YSFLPTHQPG IRSDAFGQLS QPHLYSPMEG PTRTPSFPPG NEHLPRIHAT QSHSSRVKEE  300
HDAYTQSQSS RVRLSSPQEK QGFSYPSPPR DSNVAPKREP PTNMADTGMN SNFSDHPIVG  360
QENPGGEVSH NDSILRMEKK RKADDTKGSR DVEASEMKTR KELEKQDNLR RKNEERLRKE  420
MEKQDRERRK EEERQMRERQ REEERSKREQ RREVERKEKF LQKESLRAEK RRQKEELRKE  480
KEAERRKAAL EKANARRIAK ESMELIEDEQ LELMELAAAS KGFSSIIHID LNTLQNLESF  540
RDSLCVFPPT SVKLKKPFAV QPWSNSEQNV GNLLMAWRFL ITFADVLELW PFTLDEFVQA  600
FHDYV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18895RRLKDKKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1584971e-80AC158497.2 Medicago truncatula chromosome 2 clone mth2-48e18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003593644.10.0homeobox domain protein
SwissprotQ9FFH11e-145RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A0L9VFB60.0A0A0L9VFB6_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S2Q50.0A0A0S3S2Q5_PHAAN; Uncharacterized protein
STRINGGLYMA13G30860.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15781611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.21e-100Homeodomain-like transcriptional regulator