PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v1812030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 376aa    MW: 42245.5 Da    PI: 6.5037
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v1812030.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-093023381955
                      HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       +k +yps++++  LA+++gL+++q+ +WF N+R ++
  Lj6g3v1812030.1 302 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 338
                      45679*****************************885 PP

2ELK413.8e-14258279122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK qLlrKYsgyLgsLkqEF+
  Lj6g3v1812030.1 258 ELKGQLLRKYSGYLGSLKQEFM 279
                      9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.4E-19121165IPR005540KNOX1
PfamPF037904.9E-22122160IPR005540KNOX1
SMARTSM012562.1E-25172223IPR005541KNOX2
PfamPF037911.4E-20175222IPR005541KNOX2
PROSITE profilePS5121311.174258278IPR005539ELK domain
SMARTSM011882.8E-8258279IPR005539ELK domain
PfamPF037896.3E-11258279IPR005539ELK domain
PROSITE profilePS5007113.086278341IPR001356Homeobox domain
SMARTSM003891.2E-12280345IPR001356Homeobox domain
SuperFamilySSF466891.84E-19280356IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-28283344IPR009057Homeodomain-like
CDDcd000861.26E-12290342No hitNo description
PfamPF059206.9E-17298337IPR008422Homeobox KN domain
PROSITE patternPS000270316339IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MEGNNSNCNG PSSSYLMAFG ENSGGLCPMS MMMMPLVTSH HQINPPNPHH HHNNNNNNAN  60
TNNCLFLPIP SSTNCNSSAS PSIMLDNNTT PTNNPGLGYY FMESDHHHHN NNNGSSSSSS  120
PAVKAKIMAH PLYQRLLAAY VNCQKVGAPP EVVARLEEAC GSAVGMAGDA VGSGCIGEDP  180
ALDQFMEAYC EMLTKYEQEL SKPLKEAMLF LQRIEFQFKN LTVSSDVGCN EGTERNTGSS  240
EEDADLYNMI DPQAEDRELK GQLLRKYSGY LGSLKQEFMK KRKKGKLPKE ARQQLLEWWS  300
RHYKWPYPSE SQKLALAEST GLDQKQINNW FINQRKRHWK PSEDMQFMVV DPSHPHYYMD  360
NVMSAPFPMD LSNHML
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1273282LKQEFMKKRK
2279283KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7902460.0AY790246.1 Lotus corniculatus var. japonicus homeobox knotted-1-like protein KNOX1 (KN1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014518713.10.0PREDICTED: homeobox protein SBH1-like isoform X1
RefseqXP_014518714.10.0PREDICTED: homeobox protein SBH1-like isoform X1
RefseqXP_014518715.10.0PREDICTED: homeobox protein SBH1-like isoform X1
SwissprotP466081e-176HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0S3S3Z40.0A0A0S3S3Z4_PHAAN; Uncharacterized protein
STRINGGLYMA15G11850.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-127KNOX/ELK homeobox transcription factor