PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v1694980.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 264aa    MW: 28967.7 Da    PI: 6.9532
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v1694980.3genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.29.3e-343690155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprlrWt++LHerFv+av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Lj6g3v1694980.3 36 KPRLRWTQDLHERFVDAVTQLGGPSKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 90
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-323391IPR009057Homeodomain-like
PROSITE profilePS5129410.3413393IPR017930Myb domain
TIGRFAMsTIGR015572.4E-243691IPR006447Myb domain, plants
SuperFamilySSF466899.5E-173692IPR009057Homeodomain-like
PfamPF002498.9E-83889IPR001005SANT/Myb domain
PfamPF143793.6E-15131175IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MYPRLIHPHE GMIGHDGGGV PNHKGDPCLV LTADPKPRLR WTQDLHERFV DAVTQLGGPS  60
KATPKAIMRT MNVKGLTLFH LKSHLQKYRL GKQSGKDFSE GCKDGSYLLE SPGSDNPSPK  120
LPTSDTNEGY EIKEALRAQM EVQSKLHLQV EAEKHLQIRQ EAERRYMAMV ERACKMLADQ  180
FISATVTGTD NQKFQGIGSK APRGSLVDHP GFYSLPSTEA AGVSVPEEER PHNLPSQRAD  240
CSTESCLTSH ESSGGLVLEG SPSE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-193692157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-193692157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-193692157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-193692157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.70620.0cell culture| pod| root
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj6g3v1694980.3
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1455290.0BT145529.1 Lotus japonicus clone JCVI-FLLj-1B1 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004486389.11e-171protein PHR1-LIKE 2-like isoform X1
RefseqXP_004486390.11e-171protein PHR1-LIKE 2-like isoform X1
SwissprotQ94A571e-66PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLI3SYI11e-179I3SYI1_LOTJA; Uncharacterized protein
STRINGXP_004486388.11e-171(Cicer arietinum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.15e-69G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]