PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v1088990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 349aa    MW: 39542.4 Da    PI: 6.6532
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v1088990.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.42.1e-072853172254
                      SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       +yp++e++++L +++gL+ +q+ +WF N+R +
  Lj6g3v1088990.1 285 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 317
                      59*****************************87 PP

2ELK29.61.5e-10238259122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELKh+L+++Y+ +++++++E++
  Lj6g3v1088990.1 238 ELKHELKQGYKDKIVDIREEIL 259
                      9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.8E-772117IPR005540KNOX1
PfamPF037902.6E-1084115IPR005540KNOX1
SMARTSM012564.6E-26124180IPR005541KNOX2
PfamPF037916.0E-19130179IPR005541KNOX2
SMARTSM011885.1E-4238259IPR005539ELK domain
PROSITE profilePS512139.969238258IPR005539ELK domain
PfamPF037891.1E-5238259IPR005539ELK domain
PROSITE profilePS5007111.742258321IPR001356Homeobox domain
SuperFamilySSF466893.34E-16260325IPR009057Homeodomain-like
SMARTSM003892.2E-10260325IPR001356Homeobox domain
CDDcd000865.29E-11261322No hitNo description
Gene3DG3DSA:1.10.10.601.4E-24265322IPR009057Homeodomain-like
PfamPF059209.1E-18278317IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MAYHDHLSHE ISFQQFTDDQ QMSHQGRDMQ QRMMPLSAPG GGAAPTWLNN AAALRQQNFL  60
HLQPDSAAQN DDVVRGLMEK RPRLYVQLLS AHVSCLRIAT PVDQLPRIDA QLQQAQRVVD  120
KYSRLGNGVV DEKELDQFMT HYVLLLCAFK EQLQQHVRVH AMEAVMACWE LEQSLQSLTG  180
VSPGEGTGAT MSDDEEDQAE SNAANLYEGS MDGADSLSFG PLVPTESERS LMERVRQELK  240
HELKQGYKDK IVDIREEILR KRRAGKLPGD TTSLLKQWWQ SHSKWPYPTE EDKARLVQET  300
GLQLKQINNW FINQRKRNWH TNPSSSTGAG TKTKRKSSGA GETSNQSFM
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.29650.0cell culture| floral bud| pod| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004514060.10.0PREDICTED: homeobox protein knotted-1-like LET12 isoform X1
SwissprotP480001e-154KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A072V8D40.0A0A072V8D4_MEDTR; Class II knotted-like homeobox protein
STRINGGLYMA09G12820.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-155KNOTTED1-like homeobox gene 3