PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v1078590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family ARR-B
Protein Properties Length: 674aa    MW: 73328 Da    PI: 6.9142
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v1078590.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.85.8e-29211264155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr++W+ eLH++Fv av+qL G +kA+Pk+il++m+v+gLt+e+v+SHLQkYRl
  Lj6g3v1078590.1 211 KPRVVWSVELHKKFVAAVNQL-GLDKAVPKKILDMMNVEGLTRENVASHLQKYRL 264
                      79*******************.********************************8 PP

2Response_reg85.71.3e-28261341109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vdD+p+ +++l+++l+k +y +v+ + ++ eal++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++ +++ + ++ 
  Lj6g3v1078590.1  26 VLAVDDDPTCLRVLENLLRKCQY-HVTITNQAVEALKMLRENRnkFDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSAHSDTKLVMKGVRH 117
                      799********************.***************999889*******************87754.558********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l Kp+ +eel +
  Lj6g3v1078590.1 118 GAVDYLLKPVRIEELKN 134
                      **************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23005.5E-4323157No hitNo description
SuperFamilySSF521723.98E-3723145IPR011006CheY-like superfamily
SMARTSM004486.5E-3524136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.63225140IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.1E-2626134IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.41E-3027139No hitNo description
PROSITE profilePS5129411.409208267IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-30208268IPR009057Homeodomain-like
SuperFamilySSF466896.81E-20209268IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-24211264IPR006447Myb domain, plants
PfamPF002491.7E-8213263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MAVENQRGHL VDEDAGRDRF PVGMRVLAVD DDPTCLRVLE NLLRKCQYHV TITNQAVEAL  60
KMLRENRNKF DLVISDVNMP DMDGFKLLEL VGLEMDLPVI MLSAHSDTKL VMKGVRHGAV  120
DYLLKPVRIE ELKNIWQHVV RRKTSDGKDQ NKASNEERGP NVSGGGSQGI ISENSADQNR  180
KLGKKRKDQN EEEDEDGDGN GEDDDPSSQK KPRVVWSVEL HKKFVAAVNQ LGLDKAVPKK  240
ILDMMNVEGL TRENVASHLQ KYRLYLKKAT QQVNMVAAFG GGDAYLRMGA IDGFGDFCTS  300
SASGRISSAT LPSYASNGIF GRLNSPASLS LRGISSPSLI RPVPSQNINN SLNTLATIQP  360
SIFPANQSPS LLQGIPTSIE LNQSKQNGCP TGISQLSQVD SSRFAVAASG FSDSRATVSN  420
SNSSLPGVSN NHLMLHGNPH QTHNAGAFRN QSSVRAPSLS TDSFDIGIGG SSNLLDYNRC  480
NENWQNASQL SKFPANSLPL CEAFNNDQLP PTSINVSNSS THIDNSQVGF SSGIAIAAPM  540
GDARNDLRCQ EGLIGNVIQP SSYTARERWE DYNQNTSRPF NPVNSQVSPH GVTGSLRNSL  600
SQNKAMCSNS ASLAGHLNGA STSIARCTEV ENFSSDMRLK SNEAYMLEQM KSHDGFMQNF  660
GTLDDIMGAM VKRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-25207270164ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.34080.0floral bud| pod
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj6g3v1078590.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0103010.0AP010301.1 Lotus japonicus genomic DNA, chromosome 6, clone: LjT46O03, TM1904, complete sequence.
GenBankAP0103020.0AP010302.1 Lotus japonicus genomic DNA, chromosome 6, clone: LjT40N16, TM2033, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003533888.20.0two-component response regulator ARR12 isoform X1
RefseqXP_020222712.10.0two-component response regulator ORR24 isoform X2
RefseqXP_028180904.10.0two-component response regulator ARR12-like
RefseqXP_028223105.10.0two-component response regulator ARR12-like
SwissprotQ6K8X61e-140ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A445EYI60.0A0A445EYI6_GLYSO; Two-component response regulator
STRINGGLYMA09G14650.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-127response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]