PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v1078260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 456aa    MW: 49479.3 Da    PI: 8.6569
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v1078260.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY75.85e-24147203259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       DgynWrKYGqK+vk+   +rsYYrCt++ C++kk ve +++ ++v ei+Y+++H h+
  Lj6g3v1078260.1 147 TDGYNWRKYGQKQVKSPIGSRSYYRCTHSACCAKK-VEFCDHSGHVSEIVYKSQHSHD 203
                      7********************************98.*********************7 PP

2WRKY94.66.9e-30320376359
                      -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      Dgy+WrKYGqK+vkg+++pr+YYrCtsagCp++k++e++ +d + v+itY+g H+h+
  Lj6g3v1078260.1 320 DGYRWRKYGQKMVKGKPHPRNYYRCTSAGCPARKHIETAVDDSNDVIITYKGVHDHD 376
                      9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081117.752141205IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-20143205IPR003657WRKY domain
SuperFamilySSF1182909.94E-20145205IPR003657WRKY domain
SMARTSM007743.1E-23146204IPR003657WRKY domain
PfamPF031061.2E-16148203IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.2E-31303378IPR003657WRKY domain
PROSITE profilePS5081131.502313378IPR003657WRKY domain
SuperFamilySSF1182908.5E-27314378IPR003657WRKY domain
SMARTSM007741.3E-32318377IPR003657WRKY domain
PfamPF031062.7E-23320375IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MAETATPRLT HSPPPPPSTE LRTSSPPDEA QPNLETLATP SSPPRHHTDH LQGSSTAPEN  60
GKDETEAPAR PPGNEIIVKD AVEEPQVETK NQLQACSTPL SAPSPMVPEQ RLSPPKATSV  120
YVLEVDKTTP SSGTTFSSVP VARSSATDGY NWRKYGQKQV KSPIGSRSYY RCTHSACCAK  180
KVEFCDHSGH VSEIVYKSQH SHDPPHKTNP AKESKSLASK EPNVENTVPK QSVKVLNDSD  240
PSPSPKNPLQ EAPRNPDKKR QNSSDSGNGK VTFKEEDINE PELKRRMKKD DSTCLDSPIK  300
SGKKQKFVVH AAGDVGISGD GYRWRKYGQK MVKGKPHPRN YYRCTSAGCP ARKHIETAVD  360
DSNDVIITYK GVHDHDMPVP KKRHGQPNAP LVAAAAPASM SNLQLMKTDS PKNQKNSQCS  420
GEIGGELTGE ASELGGEKAI ESARALLSIG FEIKPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A8e-25306378274WRKY transcription factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.46540.0cell culture| floral bud| flower| pod| root
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj6g3v1078260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0102990.0AP010299.1 Lotus japonicus genomic DNA, chromosome 6, clone: LjT02F19, TM1353, complete sequence.
GenBankAP0103000.0AP010300.1 Lotus japonicus genomic DNA, chromosome 6, clone: LjB04H20, BM2019, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027364748.10.0probable WRKY transcription factor 32 isoform X2
SwissprotP595831e-118WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A445EYU80.0A0A445EYU8_GLYSO; Putative WRKY transcription factor 32
TrEMBLK7KWJ70.0K7KWJ7_SOYBN; WRKY transcription factor
STRINGGLYMA06G27440.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51983456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-108WRKY DNA-binding protein 32