PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v0802160.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 546aa    MW: 59637.1 Da    PI: 7.2173
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v0802160.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1016.9e-32195252260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers+ d+k++ei+Y+g+H+h+k
  Lj6g3v0802160.2 195 DDGYNWRKYGQKLVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGKITEIIYKGTHDHPK 252
                      8****************************************.***************85 PP

2WRKY106.31.5e-33369427159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  Lj6g3v0802160.2 369 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 427
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.938189253IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.7E-27192253IPR003657WRKY domain
SuperFamilySSF1182909.68E-25193253IPR003657WRKY domain
SMARTSM007743.4E-34194252IPR003657WRKY domain
PfamPF031061.6E-24195251IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-37354429IPR003657WRKY domain
SuperFamilySSF1182902.35E-29361429IPR003657WRKY domain
PROSITE profilePS5081138.825364429IPR003657WRKY domain
SMARTSM007743.1E-39369428IPR003657WRKY domain
PfamPF031063.2E-26370427IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MDAGEAHSDL RRNGDDPTRP DSRSDSATDG AAATGGARYK LMMPAKLPIS RSPCVTIPPG  60
LSPSSFLESP VLLSNMKVEP SPTTGSLPRL QQTAHGFVIS AAFPVATVPA DFEDHVSDKS  120
TQNGQVKAVK SEIAVPSNEV GRSSPVHMVS SGASTHVEVN SHELNPRGNI ATGPQASQIE  180
GGAGGLPVAA DRASDDGYNW RKYGQKLVKG SEFPRSYYKC THPNCEVKKL FERSHDGKIT  240
EIIYKGTHDH PKPPPNRRYS TGTIISMPEE RYDKAYLTSR DDKGFNNYGQ VSHTAEPDST  300
PELSPSATND DSVEGIGFLS NRNNDEVDDD DPFLKRRKMD LGNIDITPVV KPIREPRVVV  360
QTLSEVDILD DGYRWRKYGQ KVVRGNPNPR SYYKCTNAGC PVRKHVERAS HDPKAVITTY  420
EGKHNHDVPI ARNSCHDHMA GQATAQTRIR AEESDTISLD LGMGISQAAE NRSNNQGRMV  480
LSEFGDSQTH TSNSNFKFVH TAPASVYLGV LNNNNSHPYG SKENPSDRNH SAYPCPQNMG  540
RILMGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-36195429877Probable WRKY transcription factor 4
2lex_A1e-36195429877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.200630.0floral bud
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj6g3v0802160.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0097890.0AP009789.1 Lotus japonicus genomic DNA, chromosome 6, clone: LjT11E14, TM2023, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027343728.10.0probable WRKY transcription factor 20 isoform X1
SwissprotQ93WV01e-164WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A151S5230.0A0A151S523_CAJCA; Putative WRKY transcription factor 20
STRINGGLYMA18G09040.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-165WRKY family protein