PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v0802160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 572aa    MW: 62696.5 Da    PI: 7.511
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v0802160.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1017.3e-32221278260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers+ d+k++ei+Y+g+H+h+k
  Lj6g3v0802160.1 221 DDGYNWRKYGQKLVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGKITEIIYKGTHDHPK 278
                      8****************************************.***************85 PP

2WRKY106.21.6e-33395453159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  Lj6g3v0802160.1 395 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 453
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.938215279IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.3E-27218279IPR003657WRKY domain
SuperFamilySSF1182901.03E-24219279IPR003657WRKY domain
SMARTSM007743.4E-34220278IPR003657WRKY domain
PfamPF031061.7E-24221277IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.5E-37380455IPR003657WRKY domain
SuperFamilySSF1182902.48E-29387455IPR003657WRKY domain
PROSITE profilePS5081138.825390455IPR003657WRKY domain
SMARTSM007743.1E-39395454IPR003657WRKY domain
PfamPF031063.4E-26396453IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MDAGEAHSDL RRNGDDPTRP DSRSDSATDG AAATGGARYK LMMPAKLPIS RSPCVTIPPG  60
LSPSSFLESP VLLSNMKVEP SPTTGSLPRL QQTAHGFVIS AAFPVATVCF NTNTVDNRKL  120
SFFDLKSHCR SNMVPADFED HVSDKSTQNG QVKAVKSEIA VPSNEVGRSS PVHMVSSGAS  180
THVEVNSHEL NPRGNIATGP QASQIEGGAG GLPVAADRAS DDGYNWRKYG QKLVKGSEFP  240
RSYYKCTHPN CEVKKLFERS HDGKITEIIY KGTHDHPKPP PNRRYSTGTI ISMPEERYDK  300
AYLTSRDDKG FNNYGQVSHT AEPDSTPELS PSATNDDSVE GIGFLSNRNN DEVDDDDPFL  360
KRRKMDLGNI DITPVVKPIR EPRVVVQTLS EVDILDDGYR WRKYGQKVVR GNPNPRSYYK  420
CTNAGCPVRK HVERASHDPK AVITTYEGKH NHDVPIARNS CHDHMAGQAT AQTRIRAEES  480
DTISLDLGMG ISQAAENRSN NQGRMVLSEF GDSQTHTSNS NFKFVHTAPA SVYLGVLNNN  540
NSHPYGSKEN PSDRNHSAYP CPQNMGRILM GP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-36221455877Probable WRKY transcription factor 4
2lex_A2e-36221455877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.200630.0floral bud
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj6g3v0802160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0097890.0AP009789.1 Lotus japonicus genomic DNA, chromosome 6, clone: LjT11E14, TM2023, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027343728.10.0probable WRKY transcription factor 20 isoform X1
SwissprotQ93WV01e-168WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A151S5230.0A0A151S523_CAJCA; Putative WRKY transcription factor 20
STRINGGLYMA18G09040.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39463463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-169WRKY family protein