PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v0467050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family LBD
Protein Properties Length: 124aa    MW: 14000.7 Da    PI: 4.122
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v0467050.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26060.16e-1976443100
           DUF260  43 lkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                      + +l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+ +la++++e
  Lj6g3v0467050.1   7 STMLQELPFDQRADAVSSLVYEAHARVRDPVYGCVGAISYLQNQVSELQMQLAVAQAE 64 
                      679***************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.525165IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-17762IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MVIDQNSTML QELPFDQRAD AVSSLVYEAH ARVRDPVYGC VGAISYLQNQ VSELQMQLAV  60
AQAEILCIQM QNEPVMPNPE LDLDQKSYLL QNDLPQYLNY TSSSNVIHHD SLSRESIFGH  120
DMVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003552226.11e-66PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW32e-39LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A151SP044e-68A0A151SP04_CAJCA; LOB domain-containing protein 12
STRINGGLYMA18G02780.13e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-40LBD family protein