PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v2241390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 314aa    MW: 34998 Da    PI: 8.1108
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v2241390.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1054.5e-331972255
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     prlrWtpeLH++Fv+a+e+LGG++kAtPk +l++m+vkgLt++hvkSHLQ+YR+
  Lj5g3v2241390.1 19 PRLRWTPELHRCFVHAIESLGGHHKATPKLVLQMMDVKGLTISHVKSHLQMYRS 72
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.7811575IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-311574IPR009057Homeodomain-like
SuperFamilySSF466891.38E-151772IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-231972IPR006447Myb domain, plants
PfamPF002491.3E-82071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MSSCGREGAV RQYIRSKVPR LRWTPELHRC FVHAIESLGG HHKATPKLVL QMMDVKGLTI  60
SHVKSHLQMY RSMRGELGRQ GRTISSQQHG NQSFEEHDDG CVDQANNDVG VQLQHSCSNP  120
NIRRESDSSF GYSNLTSKRA RTSSISESQR ICDAVPNPYC FYDYLGEQKN GIKEFCGGSR  180
WQQIKTQQPH STPFPLLPDF PNLTSFKCPN QESDFLQVTK LNDRKITSQP INVLENREKA  240
HAEVEGVGGG GYNELSLSLT LPNPSPQRSN GSWGSEISEA ISSYPGFSNY KDCSSSSTVK  300
ERVNLDLSLA ICGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A8e-202074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-202074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-202074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-202074357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj5g3v2241390.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0098581e-165AP009858.1 Lotus japonicus genomic DNA, chromosome 5, clone: LjT14K23, TM1780a, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007142823.11e-151hypothetical protein PHAVU_007G019900g
TrEMBLV7BAB21e-150V7BAB2_PHAVU; Uncharacterized protein
STRINGXP_007142823.11e-150(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55393353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.13e-34G2-like family protein