PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v2017090.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HD-ZIP
Protein Properties Length: 686aa    MW: 76123.8 Da    PI: 6.3821
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v2017090.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.63.4e-21101156156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      r++ +++t++q++eLe++F+++++p++++r +L+++lgL+ +qVk+WFqNrR+++k
  Lj5g3v2017090.2 101 RKRYHRHTPNQIQELENFFKECPHPDEKQRMDLSRRLGLENKQVKFWFQNRRTQMK 156
                      789999***********************************************999 PP

2START175.92.5e-553125352205
                      HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
            START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                      la++a++el+k+a+ ++p+W+ks+    e +n++e+ ++f++  +     + +ea+r++gv   ++  lve ++d + +W  +++    +a++l
  Lj5g3v2017090.2 312 LALAAMEELLKMAQTDSPLWMKSAdggkEVLNNEEYARSFSPCIGpkptgYVTEASRETGVMMINSLALVEAMMDAN-RWADMFPsmiaRAAIL 404
                      6899**********************9999**********99988********************************.*******9999***** PP

                      EEECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE CS
            START  83 evissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwve 168
                      +v+s g       galq+m ae q+lsplvp R + f+R+++q+ +g+w+++dvSv+   +  + ++++ +++lpSg+++++++ng+ kvtwve
  Lj5g3v2017090.2 405 DVVSGGissgtrnGALQVMHAEVQLLSPLVPnRQVRFLRFCKQHAEGVWAVADVSVEMGHDAATAQPFMSCRRLPSGCIVQDMPNGYAKVTWVE 498
                      *************************************************************999****************************** PP

                      -EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
            START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                      h+++++++ h+l+r+l++ g+ +ga +w atlqrq e
  Lj5g3v2017090.2 499 HWEYDENIAHQLYRPLLNCGMGFGAHRWIATLQRQSE 535
                      **********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.42E-2083158IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-2287158IPR009057Homeodomain-like
PROSITE profilePS5007117.76798158IPR001356Homeobox domain
SMARTSM003898.1E-1999162IPR001356Homeobox domain
CDDcd000861.48E-19100158No hitNo description
PfamPF000468.6E-19101156IPR001356Homeobox domain
PROSITE patternPS000270133156IPR017970Homeobox, conserved site
PROSITE profilePS5084841.119302539IPR002913START domain
SuperFamilySSF559615.36E-31304536No hitNo description
CDDcd088751.68E-110306535No hitNo description
SMARTSM002349.1E-33311536IPR002913START domain
PfamPF018525.3E-46312535IPR002913START domain
SuperFamilySSF559611.51E-11555671No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 686 aa     Download sequence    Send to blast
MGFEVLTNTK SVNSCCSVVG ARVDNMSQPM SSAMQNSPAF FSNPRGMEGH NEMGLIGEGL  60
DSGLLGRMRD DEYESRSGSD NFDGGASGDE LDGGDDLPHR RKRYHRHTPN QIQELENFFK  120
ECPHPDEKQR MDLSRRLGLE NKQVKFWFQN RRTQMKTQLE RHENLMLRQE NEKLRAENTM  180
MKEAMNNPIC NSCGGPAMPG QISFEEHQIR IENARLKDEL NRICTLTNKF LGKPMASFTS  240
PMGLPASHSG LELSIGRNGL GSSSSLGTPL PMGLDFGDGV MGTPSSMPGL TSQMGSMSRN  300
ELQLDRSMLI DLALAAMEEL LKMAQTDSPL WMKSADGGKE VLNNEEYARS FSPCIGPKPT  360
GYVTEASRET GVMMINSLAL VEAMMDANRW ADMFPSMIAR AAILDVVSGG ISSGTRNGAL  420
QVMHAEVQLL SPLVPNRQVR FLRFCKQHAE GVWAVADVSV EMGHDAATAQ PFMSCRRLPS  480
GCIVQDMPNG YAKVTWVEHW EYDENIAHQL YRPLLNCGMG FGAHRWIATL QRQSECLAVL  540
MSSISSGDHT AMNQDGRRSM LKLAQRMTKN FCSGVCASSV HKWELLHLGN MGDDMRVMTR  600
KNLDDPGEPH GIVLSAATSV WMPVSRQRLF DFLRDEQLRS EWDILSNGGP MQEMVHIAKG  660
QGQGNCVSLL RASVSDLLLY YCLFAV
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in trichomes forming at the base of young leaves, in endodermal cell lines around emergent lateral roots and in the epidermal layer of the stamen filament. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj5g3v2017090.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150415e-59AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014514419.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_022641349.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLA0A1S3V8F60.0A0A1S3V8F6_VIGRR; homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
STRINGXP_007143378.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Horstman A, et al.
    AIL and HDG proteins act antagonistically to control cell proliferation.
    Development, 2015. 142(3): p. 454-64
    [PMID:25564655]