PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v1811810.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GATA
Protein Properties Length: 245aa    MW: 26949.7 Da    PI: 9.9053
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v1811810.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.86.4e-18155188134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  Lj5g3v1811810.2 155 CMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 188
                      99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.7E-16149199IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.583149185IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.106.1E-15153186IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577165.23E-15153212No hitNo description
CDDcd002021.84E-13154211No hitNo description
PfamPF003201.5E-15155188IPR000679Zinc finger, GATA-type
PROSITE patternPS003440155180IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MKKVEHQQPS STITTKEDSV HNQFQTSSPV SVLESSSSCS GGKPAEIYIP VPCGRARSKR  60
PRPASFNPRS AMQLISPASS FIGENNTMKP NYHHHVRTSS DSENFAESQP VITKMMMPKQ  120
ASGEPKKKKK IKVPLPLAPS DGNNIQNGSQ PVRKCMHCEI TKTPQWRAGP MGPKTLCNAC  180
GVRYKSGRLF PEYRPAASPT FCPAVHSNSH KKVLEMRCKG EDSGLADQPE LIPNTNSSLT  240
LEEYM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15862KRPRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.252550.0floral bud| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj5g3v1811810.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020229701.11e-115GATA transcription factor 8 isoform X2
TrEMBLA0A151SE251e-114A0A151SE25_CAJCA; GATA transcription factor
STRINGXP_004496271.11e-103(Cicer arietinum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.24e-43GATA family protein