PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v1811810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GATA
Protein Properties Length: 351aa    MW: 38050.8 Da    PI: 6.2368
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v1811810.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA551.1e-17261294134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  Lj5g3v1811810.1 261 CMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 294
                      99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169929.4E-733344IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.583255291IPR000679Zinc finger, GATA-type
SMARTSM004011.7E-16255305IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.5E-15259318No hitNo description
Gene3DG3DSA:3.30.50.101.0E-14259292IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.30E-14260317No hitNo description
PROSITE patternPS003440261286IPR000679Zinc finger, GATA-type
PfamPF003202.4E-15261294IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MVGPNFMDEL DCGSFFDHID DLLDFPVEDV DGTATTLPSA AAAAANCTSL ASIWPPETDS  60
FPGSDSVFSG NSGSDLSAGL SVPYEDIVQL EWLSNFVEDS YGGSLTMKKV EHQQPSSTIT  120
TKEDSVHNQF QTSSPVSVLE SSSSCSGGKP AEIYIPVPCG RARSKRPRPA SFNPRSAMQL  180
ISPASSFIGE NNTMKPNYHH HVRTSSDSEN FAESQPVITK MMMPKQASGE PKKKKKIKVP  240
LPLAPSDGNN IQNGSQPVRK CMHCEITKTP QWRAGPMGPK TLCNACGVRY KSGRLFPEYR  300
PAASPTFCPA VHSNSHKKVL EMRCKGEDSG LADQPELIPN TNSSLTLEEY M
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1164168KRPRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.252550.0floral bud| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj5g3v1811810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020229701.10.0GATA transcription factor 8 isoform X2
TrEMBLA0A151SE251e-179A0A151SE25_CAJCA; GATA transcription factor
STRINGXP_007143712.11e-172(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48873356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.28e-42GATA family protein