PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v1774720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 384aa    MW: 42408.8 Da    PI: 8.8444
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v1774720.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like993.2e-31211266156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+++LH+rF++a++qLGG++ AtPk+i+e m+v gLt+++vkSHLQkYRl+
  Lj5g3v1774720.1 211 KQRRCWSQDLHKRFLHALQQLGGPDTATPKQIREKMNVGGLTNDEVKSHLQKYRLH 266
                      79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.043208268IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-27209269IPR009057Homeodomain-like
SuperFamilySSF466892.33E-17209269IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-26211266IPR006447Myb domain, plants
PfamPF002491.0E-7213264IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MIFTEKMQCM KMRFPNYIQA LEEELLKIQV FSKELPLSLE LVTQAIEACK QQLSGTTTEN  60
GQSECSEQTT SMGERVLEEF IPIKKRASTY CDEDELHSHE KNVSKGDKNN TDERKMDWLR  120
SVQLWNPDPP AGEDVTRKVP VMMDLMRSGC GGGGAFQPFH KEERAEKTIE SLSKAPSSSS  180
PVATASSTAA KATTSHSGES RKRVEKEGQR KQRRCWSQDL HKRFLHALQQ LGGPDTATPK  240
QIREKMNVGG LTNDEVKSHL QKYRLHSKRP SPAVHNTANS QTAPFVLVGN IFVQQPQYAA  300
ASGELNKVMA PAGIYAPVAT HPPAVSHTPD ASIKKPEFKK LKLFEQSNLE ERANNHSVGG  360
GVHSNSPSSS SSTHTTTTSP GCRV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.108875e-52root
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj5g3v1774720.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0049350.0AP004935.1 Lotus japonicus genomic DNA, chromosome 5, clone: LjT02L13, TM0095b, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027366647.11e-175transcription factor HHO3-like isoform X1
TrEMBLA0A371F4N21e-167A0A371F4N2_MUCPR; Transcription factor HHO3
STRINGGLYMA20G32770.11e-167(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.17e-77G2-like family protein