PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v1597270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 167aa    MW: 18652.8 Da    PI: 8.7783
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v1597270.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY110.29.2e-351067259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                     +Dgy+WrKYGqK vk+s+fprsYYrCtsa+C+vkk+vers +dp++v++tYeg+H+h+
  Lj5g3v1597270.1 10 EDGYRWRKYGQKAVKNSPFPRSYYRCTSASCNVKKRVERSFTDPSIVVTTYEGQHTHS 67
                     8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-33269IPR003657WRKY domain
SuperFamilySSF1182901.44E-29369IPR003657WRKY domain
PROSITE profilePS5081131.743469IPR003657WRKY domain
SMARTSM007743.2E-40968IPR003657WRKY domain
PfamPF031064.1E-271066IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MTKSEVDHLE DGYRWRKYGQ KAVKNSPFPR SYYRCTSASC NVKKRVERSF TDPSIVVTTY  60
EGQHTHSSPV MPRAGFGGAP IRPGYSTACG ATNFGSVLQG NYLSQYQHHP HQHLVNTLSS  120
LQGFPYSDSP SSKNAAFVTQ EMQHATAFLM DHGLLQDVVP SHMLKEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-292701078Probable WRKY transcription factor 4
2lex_A2e-292701078Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.133140.0cell culture| protoplast
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj5g3v1597270.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0962662e-70BT096266.1 Soybean clone JCVI-FLGm-20H23 unknown mRNA.
GenBankDQ3226972e-70DQ322697.1 Glycine max WRKY51 mRNA, complete cds.
GenBankDQ3226982e-70DQ322698.1 Glycine max WRKY54 mRNA, complete cds.
GenBankKT0312302e-70KT031230.1 Glycine max clone HN_CCL_159 WRKY transcription factor (Glyma03g37940.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003591381.18e-74probable WRKY transcription factor 23
SwissprotO229004e-51WRK23_ARATH; WRKY transcription factor 23
TrEMBLA0A445LI016e-73A0A445LI01_GLYSO; WRKY transcription factor 23 isoform C
TrEMBLA0A445LI125e-73A0A445LI12_GLYSO; WRKY transcription factor 23 isoform B
TrEMBLG7ICW12e-72G7ICW1_MEDTR; WRKY transcription factor
STRINGAES616323e-73(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100234114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.12e-53WRKY DNA-binding protein 23
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Guo D,Qin G
    EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses.
    Plant Signal Behav, 2016. 11(3): p. e1150404
    [PMID:26914912]
  4. PrĂ¡t T, et al.
    WRKY23 is a component of the transcriptional network mediating auxin feedback on PIN polarity.
    PLoS Genet., 2018. 14(1): p. e1007177
    [PMID:29377885]