PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v0900910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 420aa    MW: 46746.1 Da    PI: 6.785
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v0900910.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.64.3e-31246300155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r+rWt++LHe+Fv +v++LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Lj5g3v0900910.1 246 KTRIRWTQDLHEKFVACVNSLGGAEKATPKAILRLMESDGLTIFHVKSHLQKYRT 300
                      68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.4E-28244301IPR009057Homeodomain-like
SuperFamilySSF466895.02E-16244300IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-23246301IPR006447Myb domain, plants
PfamPF002494.1E-7250299IPR001005SANT/Myb domain
PfamPF143794.3E-20331377IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MNENKIDFVG RIQPSPGDFN SEFGNYFCQY FDVRQGLNMG TCGGGVEQPP YIGQARSSNN  60
TIISHFESPA SAFYATEIYM GFPQYDCQIG NGNGSGNPSL ITQSKTHDLE FPLYQNPKET  120
LFLDSPNQSG PNFELSNPLQ SQLNSDQCCG SPENSNKIPC GTFPGDNFLP IEQHKLFIDD  180
AVSVYRSQSN VSKGNQDNNM GPYNLPQTQI KFSSHPQDKL SPTLSAGSVS TITGNPACSG  240
PAVSSKTRIR WTQDLHEKFV ACVNSLGGAE KATPKAILRL MESDGLTIFH VKSHLQKYRT  300
AKYMPEAAQG KSDNKRTHVE NVHLDVKTGL QIREALQLQL DVQRHLHEQL EIQRKLQMRI  360
EEQGKQLKMM FDQQQKTSNS ILNTRNLSNT DNNDKPISPK DVEVSISEGS EKSFFHSKIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-24246303259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-24246303259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-24246303158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-24246303158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-24246303158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-24246303158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-24246303259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-24246303259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-24246303259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-24246303259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-24246303259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-24246303259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.18561e-142root
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj5g3v0900910.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2361412e-35AC236141.2 Glycine max clone GM_WBb0004A16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027366587.10.0protein PHOSPHATE STARVATION RESPONSE 3-like
TrEMBLA0A371HXH70.0A0A371HXH7_MUCPR; Myb family transcription factor PHL5 (Fragment)
STRINGXP_007145673.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.14e-70G2-like family protein