PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v0659720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 464aa    MW: 51664.6 Da    PI: 5.0138
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v0659720.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.71.1e-27133186155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr++W+ eLH++F+ av+qL G++kA+Pk++l++m+v+ Lt+e+v+SHLQkYRl
  Lj5g3v0659720.1 133 KPRVVWSGELHQKFLAAVNQL-GIDKAVPKKVLKMMDVENLTRENVASHLQKYRL 186
                      79*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001566.76E-10162No hitNo description
SuperFamilySSF521722.13E-12166IPR011006CheY-like superfamily
PfamPF000723.6E-6157IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23007.0E-16180No hitNo description
PROSITE profilePS5011021.384162IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5129411.961130189IPR017930Myb domain
SuperFamilySSF466895.2E-20131190IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.2E-29131191IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-24133186IPR006447Myb domain, plants
PfamPF002491.1E-6135185IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MPEIDGFKFL ELVGLIIDIP VILLSVNGDS NMVMKGITHG ACHYMLKPVR VEELKTIWQH  60
VIRNRKIGSK EKEGTKTSSN HETLNYSDNG QGSAATPNSD QNGKSSKKRK YQDFDDVEHE  120
NGTDSGDSSA PKKPRVVWSG ELHQKFLAAV NQLGIDKAVP KKVLKMMDVE NLTRENVASH  180
LQKYRLYLKR ISSMANQQAN PILGSVSRKN AFGSRLNTPA THSSRTLQVD QFQHSKGVSH  240
IPNQNNTFML EENQRPSELS ISNNDLEDNS QDKQTGRVST SLAPQDSQFS LPLLDNDRSN  300
DVCSTEYLAN ECFGPASVSC TDNMTPVPWN ISCNAPFEGW DNHNQNSTYH SHVSGDSIGS  360
MIPANGDPVN SAFNFCDPLQ MNHDEIIELT EECSIKPHQL HVMDQQRYQN SSICNCLGSP  420
EDLDSAMMMK LVEEETDIML NLEDMIDFTG IIDLTPFLDS STGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-24129192164ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj5g3v0659720.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0105600.0AP010560.1 Lotus japonicus genomic DNA, clone: LjT18K19, TM1729, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027354576.11e-117two-component response regulator ARR12 isoform X1
TrEMBLA0A0S3RCH71e-113A0A0S3RCH7_PHAAN; Two-component response regulator
STRINGGLYMA06G06730.11e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1847535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.13e-66response regulator 12