PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v0554360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 389aa    MW: 43351 Da    PI: 6.4504
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v0554360.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.55.5e-27102155155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr++W+ eLH++F+ +v+qL G++kA+Pk++l+lm+v+ Lt+e+v+SHLQkYRl
  Lj5g3v0554360.1 102 KPRVVWSGELHQKFLAVVNQL-GIDKAVPKKVLKLMDVENLTRENVASHLQKYRL 155
                      79*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011012.139131IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23001.8E-7250No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2899160IPR009057Homeodomain-like
PROSITE profilePS5129411.0399158IPR017930Myb domain
SuperFamilySSF466891.38E-19100159IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-23102155IPR006447Myb domain, plants
PfamPF002495.0E-6104154IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MVMKGITHGA CHYMLKPVRV EELKTIWQHV IRNKKIASKE KEGTKTSSNH ETLNYSDNGQ  60
GSAATPNSDQ NGKSSKKRKY QDFDDEEHEN GTDSGDSSAQ KKPRVVWSGE LHQKFLAVVN  120
QLGIDKAVPK KVLKLMDVEN LTRENVASHL QKYRLYLKRI SSMANQQANP ILGSVSRKNA  180
FGSRLNTPAI HSSRTLQVDQ FEYSKGVSHI PNQNNTFMLE ENQRPSELSI SNNDLEDNSQ  240
DKQTGRVSTS LAPQDSQFSL PLLDNDRSND VCLTEYLANE CFGPASVSCT DNMTPVPCNI  300
SCNAPYEGWD NHNQNSTYHS HVSGNSLGST IPANGDPVNS AFNFCDPLQM DHDEIIELAE  360
ECSIKPHQLH VIDQQRYQNS SICNCLGSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-2498161164ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj5g3v0554360.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0105600.0AP010560.1 Lotus japonicus genomic DNA, clone: LjT18K19, TM1729, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027354576.13e-95two-component response regulator ARR12 isoform X1
TrEMBLA0A0B2SDX46e-91A0A0B2SDX4_GLYSO; Two-component response regulator
TrEMBLA0A445H4H97e-91A0A445H4H9_GLYSO; Two-component response regulator
TrEMBLA0A4D6NR301e-90A0A4D6NR30_VIGUN; Two-component response regulator ARR-B family
TrEMBLI1M9E97e-91I1M9E9_SOYBN; Two-component response regulator
STRINGGLYMA14G13320.11e-91(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1847535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.14e-52response regulator 12