PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v0550200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 267aa    MW: 29933.4 Da    PI: 8.0211
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v0550200.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY79.14.9e-2590147259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      dDgy+WrK Gq++ kg+ +pr Y+ Ct+agCpv+k ver+ ++ k v++tY+g+Hnhe
  Lj5g3v0550200.1  90 DDGYRWRKSGQRPSKGNLMPRRYFMCTTAGCPVRKTVERNLHNLKNVITTYKGRHNHE 147
                      8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.2E-2677149IPR003657WRKY domain
PROSITE profilePS5081129.10384149IPR003657WRKY domain
SuperFamilySSF1182906.02E-2286149IPR003657WRKY domain
SMARTSM007743.6E-2289148IPR003657WRKY domain
PfamPF031062.6E-1990147IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MPMYCYKEAG AKVDEGRPVT ENLQLGGKSN KNKVTQGSTS PSKEVDVAVV AHDSGSKRKS  60
LDYYNKALLR LIHPLPKVEV QVESIVDVPD DGYRWRKSGQ RPSKGNLMPR RYFMCTTAGC  120
PVRKTVERNL HNLKNVITTY KGRHNHEVPL EKHKDCSINV DDFHKAANSL RTVAMSGNAN  180
IRGPEANQED ENDFLRLTLG QNFNNDHVNV RSSSTNHIPG PEANQEDDND FLRLTLGQNF  240
NIDHVNVRSS STNQIPSINL EKDGDDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-2380149877Probable WRKY transcription factor 4
2lex_A6e-2380149877Probable WRKY transcription factor 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj5g3v0550200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.13e-29WRKY DNA-binding protein 33