PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v0523200.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family ARR-B
Protein Properties Length: 660aa    MW: 72165.9 Da    PI: 7.5409
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v0523200.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.62.9e-28209262155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr++W+ +LH++Fv av+qL G +kA+Pk+ile+m+v+ Lt+e+v+SHLQkYRl
  Lj5g3v0523200.2 209 KPRVVWSVDLHRKFVAAVNQL-GLDKAVPKRILEMMNVDQLTRENVASHLQKYRL 262
                      79*******************.********************************8 PP

2Response_reg82.11.7e-27231311109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vdD+p+ +++l+ +l+k +y +v+++++++ al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++ +g+++++l+ +  
  Lj5g3v0523200.2  23 VLAVDDDPICLRILEALLQKCQY-HVTATKHAPTALQLLRENKdkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSVNGDPKMVLKGITH 114
                      799********************.***************888888*******************87754.558********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l Kp+  eel++
  Lj5g3v0523200.2 115 GACDYLLKPVRVEELRN 131
                      **************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521722.56E-3420141IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.0E-4120158No hitNo description
SMARTSM004484.8E-3221133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.89322137IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.1E-2423132IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.52E-2624136No hitNo description
Gene3DG3DSA:1.10.10.601.1E-29206267IPR009057Homeodomain-like
PROSITE profilePS5129410.745206265IPR017930Myb domain
SuperFamilySSF466892.69E-19207266IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-25209262IPR006447Myb domain, plants
PfamPF002491.1E-6211261IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 660 aa     Download sequence    Send to blast
MTEVENHSKM DDPTDQFPVG MRVLAVDDDP ICLRILEALL QKCQYHVTAT KHAPTALQLL  60
RENKDKFDLV ISDVHMPDMD GFKLLELVGL EMDLPVIMLS VNGDPKMVLK GITHGACDYL  120
LKPVRVEELR NIWQHVVRKK KKTVPKEGTK TGNQDTPISH SDNGQGSAAT TNSDQNGKSS  180
KKRKDLEEDD DNEVHENGDD SDDPSAQRKP RVVWSVDLHR KFVAAVNQLG LDKAVPKRIL  240
EMMNVDQLTR ENVASHLQKY RLYLKRLSCV ENQQANMVAA LGSADLSYQQ AHMVAALGSA  300
DPSYLRTGSL SAHGHLRTLN ASRQSHNNAF RSFTHDGMVS RMNPPSSMNV QGLPSSGTLQ  360
VIQAQNLNNS MNGSQLKFHS ALIGGNQNDQ LQHNKGVSHI QNLNTNFNAK PTFPITNQRQ  420
GGLSISNNAL MLEMNPQHKL MGGVSTSLAP QQHSQFSLPL MDNGRLNDGW PSVFHSSGKN  480
SYTPSERFGP ASMTPTNNMN LSGAPSPNSL TDMHSKGVTF TNTPPGQISN SVSLQGWNNH  540
NNLSGGYNSH VIGNSIGSTI PPNGGVPDGN ASMNSTFNFG DPLQMKHDGI IELPGEPSLI  600
PHQQVHVMNQ QKPRHSRFSN SVGSLEELAS AMMMKQNHDM YGFRRDNNHS GGGGGGGAPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-23205268164ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.134000.0root
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj5g3v0523200.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2362212e-43AC236221.2 Glycine max clone GM_WBc0105L07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028208872.10.0two-component response regulator ARR12-like
SwissprotB8AEH11e-134ORR23_ORYSI; Two-component response regulator ORR23
TrEMBLA0A371HUG70.0A0A371HUG7_MUCPR; Two-component response regulator ORR23 (Fragment)
STRINGGLYMA17G33230.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-113response regulator 12