PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v0324520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GRF
Protein Properties Length: 630aa    MW: 68937.9 Da    PI: 7.1869
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v0324520.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.62.5e-24220264145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCsr+++ ++k+CErH++rgr+rsrk++e 
  Lj5g3v0324520.1 220 DPEPGRCRRTDGKKWRCSRDAVVDQKYCERHMNRGRHRSRKPVEG 264
                      79****************************************985 PP

2QLQ63.36.1e-22150186137
              QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      ++FT++Q+++L++Q+l+yKy+ an+PvP++Ll +i+k
  Lj5g3v0324520.1 150 GPFTPSQWMELEHQALIYKYITANVPVPSHLLIPIKK 186
                      59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.6E-13150186IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.351151186IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088807.6E-16151184IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.847220264IPR014977WRC domain
PfamPF088791.3E-20221263IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MDLGVVGLDG LVGSETGFVS LASDPEAKHK WYGSGFLKQE RSATTEDDDL RSSKLAKTNN  60
DDKAMQQFQL QQQNKNSSSS SLRSNATLFS DGHHQQHMLS FSSPKLETYS LDKNNPNATL  120
SYSYHPLSSY SRNTGYSSGS MHGAFAGTRG PFTPSQWMEL EHQALIYKYI TANVPVPSHL  180
LIPIKKALES AGFCNFSTGI LRPNALAWGG FHLGFSNNTD PEPGRCRRTD GKKWRCSRDA  240
VVDQKYCERH MNRGRHRSRK PVEGQSGHAV TATTTTTTNA NAATPNGLKL NASSIVVPGN  300
SACNNLTFAN QEHKNMQNPL SADNTSASNT INRMFMNCKE NDKASERMQD GPVLPMLPPT  360
LELKPKENNN PFMIQKPDFP YEEPSRNSEF GFVTSDSLLN PSQKSSPTTT TLLSSRTSAD  420
SSQQNTGSQH PLRHFIDDCP KSQSDHHHHQ QHHHRSGVSW TELDHMQSDR TQLSISTPIT  480
SSDHFLSFNS SPSNEKLTLS PLRLSRELDP IQMGLGVGSA AINESNNTTT TRQATNWIPI  540
TWESSMGGPL GEVLHLSTNN NVSDHCDKNS SDLNLMTDGW DNSPPIGSSP TGVLQKTAFG  600
SLSNSSAGSS PRAENNKTQE GASLCNDLLG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004498953.10.0PREDICTED: growth-regulating factor 1-like
TrEMBLA0A072VEY40.0A0A072VEY4_MEDTR; Growth-regulating factor
STRINGGLYMA17G35090.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.15e-91growth-regulating factor 1