PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v2785750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 237aa    MW: 26916.4 Da    PI: 8.7983
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v2785750.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.31.3e-32160218159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  Lj4g3v2785750.1 160 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHAHS 218
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.8E-34145218IPR003657WRKY domain
SuperFamilySSF1182907.98E-29153219IPR003657WRKY domain
PROSITE profilePS5081129.574155220IPR003657WRKY domain
SMARTSM007744.0E-37160219IPR003657WRKY domain
PfamPF031062.1E-25161217IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MSTTSPAIIN HSLCEDQNEI MPAQMGFVPF PITNMSFPPL DCNQSLKAFS SIASSLASEG  60
DSTSNLTVET LLATTALKSR SEHQYLTSSF GGPQFLSLHR SSVNPWALGE VTNDCFSNKR  120
SGVDDHHLRI SAMKMKKIKG RRKVREPRFC FKTLSEVDVL DDGYKWRKYG QKVVKNTQHP  180
RSYYRCTQDN CRVKKRVERL AEDPRMVITT YEGRHAHSPS NDLEDSQSPS EFTNFLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-27152217974Probable WRKY transcription factor 4
2lex_A6e-27152217974Probable WRKY transcription factor 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj4g3v2785750.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0109091e-177AP010909.1 Lotus japonicus genomic DNA, clone: LjB16K09, BM2319, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027366971.11e-133probable WRKY transcription factor 13 isoform X1
TrEMBLA0A445JEL41e-128A0A445JEL4_GLYSO; Putative WRKY transcription factor 13
TrEMBLI1KTB91e-128I1KTB9_SOYBN; Uncharacterized protein
STRINGGLYMA08G15210.11e-129(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40793361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.19e-62WRKY DNA-binding protein 13