PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v2604770.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 408aa    MW: 46389.1 Da    PI: 6.9703
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v2604770.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.11.5e-3196149255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtp+LH +Fv+ave+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  Lj4g3v2604770.2  96 PRLRWTPDLHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 149
                      8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-2992150IPR009057Homeodomain-like
PROSITE profilePS5129411.62892152IPR017930Myb domain
SuperFamilySSF466892.69E-1494150IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-2296151IPR006447Myb domain, plants
PfamPF002491.0E-897148IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MSDRYEIHDE NERSEDQGDD NSIGSSQKLS SFDLNEDACS EDNTDINDDE ACDDEITGEE  60
YEKGKDEGTS TNRSSTSREG NGRRGGVRQY VRSKMPRLRW TPDLHLSFVH AVERLGGQER  120
ATPKLVLQLM NVRGLSIAHV KSHLQMYRSK KLDEAGQVLS QPYRSTQGFG RISQAHQPMI  180
PHQHFKMGNG GIILASNYNE HSYFQGLRPQ PSSLSHSDSH SKAIDSRHQQ WYSNHQPFRR  240
PSFEFVSSTS TALQTQGRSI ASNQIQLMDT TRLAPMRPSQ FLEEKKWPPL ETMNNHHHWK  300
KNYSSQSVLH QFGTTPAALK PAELSIGTNT RIKEFLSNPD EHHNPSNSLK LEFNPPFRIK  360
LNQEKLQIDK QCVPDLQLSL SQKNSNNDGG ETDHSRETQE INTKLSLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-1797151458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-1797151458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-1797151357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1797151357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1797151357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1797151357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-1797151458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-1797151458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-1797151458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-1797151458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-1797151458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-1797151458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.166001e-145root
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj4g3v2604770.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150342e-48AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020202513.10.0two-component response regulator ARR14-like
RefseqXP_020202514.10.0two-component response regulator ARR14-like
TrEMBLA0A445KPI00.0A0A445KPI0_GLYSO; Putative Myb family transcription factor
STRINGGLYMA05G29161.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-37G2-like family protein