PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v2263940.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 418aa    MW: 45625.5 Da    PI: 8.3019
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v2263940.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1031.7e-32220278159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDg++WrKYGqK vk+s++prsYYrCt+agC vkk+vers+ed++vv++tYeg H+h+
  Lj4g3v2263940.2 220 LDDGFRWRKYGQKAVKNSPNPRSYYRCTTAGCGVKKRVERSSEDTSVVVTTYEGVHTHR 278
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.1E-33205280IPR003657WRKY domain
SuperFamilySSF1182902.88E-28213280IPR003657WRKY domain
PROSITE profilePS5081131.605215280IPR003657WRKY domain
SMARTSM007749.3E-39220279IPR003657WRKY domain
PfamPF031065.6E-26221278IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MEEKREKAEK SFSCSTMSNS VAFSDTGNPS FGSIFSFLME KMPPPPPSPP LPPLSPLPLP  60
PFHQQTSSFG SFKDLLTIED FDPALFDWNP TTTTNTAAAA DVTSPPLSTT QISHPVPSPA  120
TSNILPEYSS DVLNTPTTPN SSSISSSTNG TGNDRAEPEP EAENDDDGDA IKDQNQNQNK  180
NGRLKGKKQK QEKQEKKEKK EKKEKEPRYA FKTKSEVDNL DDGFRWRKYG QKAVKNSPNP  240
RSYYRCTTAG CGVKKRVERS SEDTSVVVTT YEGVHTHRCP AARGNYGGAA PHGLGSNQYV  300
LPSQAQNLQV QNFQNQNVQQ AAPSFSTTPS FNAATPVPPI SYRNAIIPLP FNVANPAPNT  360
HFNTSSFGSF LQGINGVDFV QSSRFMANNN QGLLRNNGLL QDMFVPAHME FGGGGGRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-25212281978Probable WRKY transcription factor 4
2lex_A1e-25212281978Probable WRKY transcription factor 4
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.138770.0cell culture| protoplast| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj4g3v2263940.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027333494.14e-83probable WRKY transcription factor 48
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100234114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.12e-37WRKY DNA-binding protein 48