PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v1983530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 507aa    MW: 55623.9 Da    PI: 8.283
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v1983530.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY81.87.1e-26198254259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +DgynWrKYGqK+vk+ + +rsYYrC++++C+vkk +er+++ ++v+ei+Y++eH h+
  Lj4g3v1983530.1 198 SDGYNWRKYGQKQVKSPTGSRSYYRCSHSDCSVKK-IERCDHSGHVIEIVYKSEHSHD 254
                      7********************************98.*********************7 PP

2WRKY97.96.6e-31370426359
                      -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ ++ ++v+itY+g H+he
  Lj4g3v1983530.1 370 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETAVDNSDAVIITYKGVHDHE 426
                      9*******************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-22191256IPR003657WRKY domain
PROSITE profilePS5081119.084192256IPR003657WRKY domain
SuperFamilySSF1182904.97E-21194256IPR003657WRKY domain
SMARTSM007746.7E-25197255IPR003657WRKY domain
PfamPF031061.7E-18199254IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.5E-31353428IPR003657WRKY domain
PROSITE profilePS5081131.732363428IPR003657WRKY domain
SuperFamilySSF1182901.28E-26364428IPR003657WRKY domain
SMARTSM007741.6E-34368427IPR003657WRKY domain
PfamPF031063.3E-23370425IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MAEHRRSSDA VTAGAPEHPH RRRKDLEGDG GSRVDEEGKE EMEEVDERVG ESLAVTELQG  60
GELRSSDELP VESNLVTLAA VPSSAVQHQS ADLQGSSATL NSSGNVESKE TAGPPEKEII  120
AREAVQAPPS QTEYQLQVSV CSTPLSELST NSVTQSSRKQ KMTPRRMNNN THEAQVDKKI  180
PSGGKSLSAV SVARTSASDG YNWRKYGQKQ VKSPTGSRSY YRCSHSDCSV KKIERCDHSG  240
HVIEIVYKSE HSHDPPRKTN SSRESKFVSS NEPTVENSVP KKPIRVLKDS DLSISSKDIQ  300
APWSGDKKRQ TLSNISDNGQ IILKEEHVNE PEQKRRMKKS DLTNLDSPVK PEKKAKFVVH  360
AAGDVGISGD GYRWRKYGQK MVKGNPNPRN YYRCTSAGCP VRKHIETAVD NSDAVIITYK  420
GVHDHEMPVP KKRHGPLRAP FVADAAPAAM NNLPSKNPDS LQNQKASTQW SVDTEGELTG  480
EAMELGGEKA MESARTLLSI GFEIKPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-24197428174WRKY transcription factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj4g3v1983530.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0103780.0AP010378.1 Lotus japonicus genomic DNA, chromosome 4, clone: LjT11D24, TM0179, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007154886.10.0hypothetical protein PHAVU_003G156300g
SwissprotP595831e-115WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLV7CC730.0V7CC73_PHAVU; Uncharacterized protein
STRINGXP_007154886.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51983456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-112WRKY DNA-binding protein 32