PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v1725040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family SBP
Protein Properties Length: 538aa    MW: 59092.6 Da    PI: 7.1599
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v1725040.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.12.2e-42157232277
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      Cqv gC++dls++k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l+efD++krsCr+rLa+hnerrrk+q
  Lj4g3v1725040.1 157 CQVYGCNKDLSSCKDYHKRHKVCEVHSKTATVIVNGTEQRFCQQCSRFHLLTEFDDGKRSCRKRLAGHNERRRKPQ 232
                      **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-33150218IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.547154231IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.65E-39155235IPR004333Transcription factor, SBP-box
PfamPF031103.1E-31157230IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MESWSFVSED QKGYSLSPPN TLGRSKNSFL GWELNTPCSF STDINMSQQN VDNQPTEELG  60
FPDMLGGKQQ FSDHDLVCSV LNRGESNSSK LTSNSVAVSN GRDSFIDLKL GRFADHGDSH  120
AFDSGFSRRV PILSSSESST PPKRVRASGM HSQTAYCQVY GCNKDLSSCK DYHKRHKVCE  180
VHSKTATVIV NGTEQRFCQQ CSRFHLLTEF DDGKRSCRKR LAGHNERRRK PQLGIHSGKS  240
GRLLQPCGDS RFQGTKLTPA SFIVPEMLPS GIMHPERYEI GGFWRPIIKA ECGGGFKHLS  300
SMSITNGHPM SRSLFPSHNQ KQFPFLHHEN GAASTTESIF CDSNGQYPPS LGAAQNSGLR  360
PLFHDTSLGS EDFNVFYTPS TVQGLSGISD SCALSLLSSQ SQNSPSQSSG IPLAHPFVIP  420
SSHSHHYSMS QVSEKIGISS HTSSSRVSDG FPSELNHADG GNLGPALISD NHDIVHFGMA  480
DGIFQQSDFV SVKDRLSCED DATIDLLQLS SQLQRVEHQR QSLQLKQEND SPCTLRIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-291572301184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj4g3v1725040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027330195.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A0L9TSL50.0A0A0L9TSL5_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R7C20.0A0A0S3R7C2_PHAAN; Uncharacterized protein
STRINGXP_007155210.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-52SBP family protein