PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v1600420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family LBD
Protein Properties Length: 229aa    MW: 26302.6 Da    PI: 4.2394
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v1600420.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26022.14.2e-0714358100
           DUF260  58 msslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                      m+s++ +A+ r + Pv+G+++ i +lq q+  +++el+++ ++
  Lj4g3v1600420.1   1 MDSIIIQANYRDKYPVHGCCEEIGRLQYQIWLVEEELHAVYQQ 43 
                      79***********************************999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031956.9E-5140IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MDSIIIQANY RDKYPVHGCC EEIGRLQYQI WLVEEELHAV YQQLEMCRQQ QQHQQHNDGM  60
ALPDDVTSQL ELGMAPRSNN ALQLFNHPPP QQQSYNTVAA ISQQHSYSNS NSVDYNNNSL  120
YMDSKDNVTN PLWVQYQYQN NNSNDSVAMQ TQLVASQQPL AIQQEVVEDY DEMHPFFDTV  180
DDRQSYVYSK EAYESSSEES LKDTRKGSEH VSENELKSAA ACFSLTSVN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.60031e-115flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj4g3v1600420.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020225931.11e-112LOB domain-containing protein 27
TrEMBLA0A371F2W31e-116A0A371F2W3_MUCPR; LOB domain-containing protein 27 (Fragment)
STRINGXP_004508794.11e-102(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-10LOB domain-containing protein 27