PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v1154490.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family ARR-B
Protein Properties Length: 538aa    MW: 60033.9 Da    PI: 6.141
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v1154490.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.37.2e-28309363156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k +++WtpeLH++Fv+aveqL G+++A+P++il+lmkv+gLt+++v+SHLQkYR++
  Lj4g3v1154490.2 309 KMKVDWTPELHKKFVKAVEQL-GIDQAIPSRILDLMKVEGLTRHNVASHLQKYRMH 363
                      5689*****************.********************************96 PP

2Response_reg29.24.8e-11201261109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTT.SEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHH CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempg.mdGlellkeireeepklpiivvtahgeeedalealk 91 
                      vl+ + + + +  l+  le  +y +v ++ d  eal  +  +   +++ ++ ++++    G+++l   ++++ +lp i+ + +   +++ +++ 
  Lj4g3v1154490.2  20 VLLLEGDSASAAELKDKLEAMDY-NVSTFCDENEALSAISSRPegFHIAIVEVSLSScQGGFKFL---QNAK-DLPTIMTSNNHCLDTMMKCIA 108
                      567777778888899999*****.***************777777************55566665...4444.899**9999999********* PP

                      TTESEEEESS--HHHHHH CS
     Response_reg  92 aGakdflsKpfdpeelvk 109
                      +Ga +flsKp ++++l +
  Lj4g3v1154490.2 109 LGAVEFLSKPLSEDKLKN 126
                      **************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23004.5E-1716163No hitNo description
SuperFamilySSF521721.39E-1616134IPR011006CheY-like superfamily
SMARTSM004482.4E-418128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011021.69419132IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.2E-920126IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.50E-1021131No hitNo description
PROSITE patternPS0017702230IPR018522DNA topoisomerase, type IIA, conserved site
PROSITE profilePS5129415.16306365IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-27307366IPR009057Homeodomain-like
SuperFamilySSF466893.85E-18308366IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-24309364IPR006447Myb domain, plants
PfamPF002498.5E-8312361IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006265Biological ProcessDNA topological change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003918Molecular FunctionDNA topoisomerase type II (ATP-hydrolyzing) activity
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MVFTANDLQE WKDFPKGLKV LLLEGDSASA AELKDKLEAM DYNVSTFCDE NEALSAISSR  60
PEGFHIAIVE VSLSSCQGGF KFLQNAKDLP TIMTSNNHCL DTMMKCIALG AVEFLSKPLS  120
EDKLKNIWQH VVHKAFNAGA SVLSESLKPV KESVMSMLER QTDQEQHEGR VSIDLENVSR  180
ITDNNNHEQY PAPSTPQLKQ GERLMDDGDC QEQTNCSTEK ESGDCDGESK FVETTSGNLN  240
AESIPQQRES EMTPVKEEEN FANASKGVSA VSPHPQNSKV LSNADSKTSS PNKAGVHGDK  300
CEIKANRKKM KVDWTPELHK KFVKAVEQLG IDQAIPSRIL DLMKVEGLTR HNVASHLQKY  360
RMHKRQILPK EESRKWLNQR DAVQRSYFHQ RPIMAYPPYH SNHTLPMPPV YPMWGPPGYP  420
LWQPTESWHW KPLPGMHADA WGCPVIPPPQ APPFTYSQQN VDALGNANAV DYTFSMPPHS  480
SFELYPAEEV VDKVVKEAIN KPWLPLPLGL KPPSTDCVIA ELSRQGISAI PPGSCSNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A1e-16314363655Transcription factor LUX
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.94230.0cell culture| floral bud
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj4g3v1154490.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-46AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027334562.10.0two-component response regulator-like APRR2 isoform X2
SwissprotQ6LA431e-150APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A2Z6M3P70.0A0A2Z6M3P7_TRISU; Uncharacterized protein (Fragment)
STRINGXP_004508999.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35663465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-141ARR-B family protein
Publications ? help Back to Top
  1. Gong L, et al.
    Transcriptome Profiling of the Potato (Solanum tuberosum L.) Plant under Drought Stress and Water-Stimulus Conditions.
    PLoS ONE, 2015. 10(5): p. e0128041
    [PMID:26010543]