PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v1154490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 383aa    MW: 43029.4 Da    PI: 6.5096
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v1154490.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like894.4e-28155209156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k +++WtpeLH++Fv+aveqL G+++A+P++il+lmkv+gLt+++v+SHLQkYR++
  Lj4g3v1154490.1 155 KMKVDWTPELHKKFVKAVEQL-GIDQAIPSRILDLMKVEGLTRHNVASHLQKYRMH 209
                      5689*****************.********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.16152211IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-27153212IPR009057Homeodomain-like
SuperFamilySSF466892.33E-18154212IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-25155210IPR006447Myb domain, plants
PfamPF002495.3E-8158207IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006265Biological ProcessDNA topological change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003918Molecular FunctionDNA topoisomerase type II (ATP-hydrolyzing) activity
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MSMLERQTDQ EQHEGRVSID LENVSRITDN NNHEQYPAPS TPQLKQGERL MDDGDCQEQT  60
NCSTEKESGD CDGESKFVET TSGNLNAESI PQQRESEMTP VKEEENFANA SKGVSAVSPH  120
PQNSKVLSNA DSKTSSPNKA GVHGDKCEIK ANRKKMKVDW TPELHKKFVK AVEQLGIDQA  180
IPSRILDLMK VEGLTRHNVA SHLQKYRMHK RQILPKEESR KWLNQRDAVQ RSYFHQRPIM  240
AYPPYHSNHT LPMPPVYPMW GPPGYPLWQP TESWHWKPLP GMHADAWGCP VIPPPQAPPF  300
TYSQNVDALG NANAVDYTFS MPPHSSFELY PAEEVVDKVV KEAINKPWLP LPLGLKPPST  360
DCVIAELSRQ GISAIPPGSC SNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-17153213363ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.94235e-58cell culture| floral bud
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj4g3v1154490.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150349e-47AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027334562.10.0two-component response regulator-like APRR2 isoform X2
RefseqXP_027334563.10.0two-component response regulator-like APRR2 isoform X3
TrEMBLA0A2Z6M3P70.0A0A2Z6M3P7_TRISU; Uncharacterized protein (Fragment)
STRINGXP_004508999.10.0(Cicer arietinum)
STRINGGLYMA17G16360.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-61ARR-B family protein