PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v1153140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family ARR-B
Protein Properties Length: 557aa    MW: 61979.8 Da    PI: 5.9151
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v1153140.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.81.1e-27313367156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k +++WtpeLH++Fv+aveqL G+++A+P++ile+mkv+gLt+++v+SHLQkYR++
  Lj4g3v1153140.1 313 KMKVDWTPELHKKFVKAVEQL-GIDHAIPSRILEIMKVEGLTRHNVASHLQKYRIH 367
                      5689*****************.********************************86 PP

2Response_reg259.7e-10211262109
                      EEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTT.SEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   2 livdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempg.mdGlellkeireeepklpiivvtahgeeedalealka 92 
                      l+ + +   +  +r  le  +y +v ++ +  eal  +      +++ ++ ++ +    G+++l++ +     lp i+ + ++  +++ +++ +
  Lj4g3v1153140.1  21 LLLEGDSGSATEIRAKLEAMDY-IVFTFYNENEALSAISSDPegFHVAVVEVSTSSnQGGFKFLENVKD----LPTIMTSNSQCLNTMMKCIAL 109
                      5566666667778899999***.***************777777*********999899******9998....66777777777********** PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga +fl+Kp ++++l +
  Lj4g3v1153140.1 110 GAVEFLTKPLSEDKLKN 126
                      *************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.6E-1516149No hitNo description
SuperFamilySSF521726.83E-1516134IPR011006CheY-like superfamily
SMARTSM004480.002818128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011020.5519132IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.2E-720126IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.14E-821131No hitNo description
PROSITE profilePS5129416.457310369IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-27311370IPR009057Homeodomain-like
SuperFamilySSF466892.6E-18312370IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-25313368IPR006447Myb domain, plants
PfamPF002491.4E-7316365IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MVCTASDLQQ WKDFPKGLRV LLLEGDSGSA TEIRAKLEAM DYIVFTFYNE NEALSAISSD  60
PEGFHVAVVE VSTSSNQGGF KFLENVKDLP TIMTSNSQCL NTMMKCIALG AVEFLTKPLS  120
EDKLKNIWQH VVHKAFNAGT NAPSESLRPV KESVESILQL QTDNGQHESN ISIDIENVSR  180
LGDNDHEQSV GSDKYPAPST PQLKQGARLL DDGDCHEQTN CSTEKESGEH DEESKSVEIS  240
CENLNTESSS QLSKPEKTLI KEEEAFADGS KGEIAVSQNE DNRKFLGSAE GNESPNKTGV  300
LSDSCEKKAN RKKMKVDWTP ELHKKFVKAV EQLGIDHAIP SRILEIMKVE GLTRHNVASH  360
LQKYRIHKKQ IMPGEDDRKC QNPRDPMQRS YCLQRPIMAY PPYHSNHTLP PAPMYPMWGQ  420
PGSQTAGVQI WGNHGYPLWH PTESWHWKPY PGMHVDAWGC PVLPSPQASP FPYTQNVAGW  480
HNAKAMDYRF SMPQSSVENY PAEEVVDKVV KEAMSKPWLP LPLGLKPPSM DTVLSELSSQ  540
GISGIIPFSS TKGSIPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A3e-17318369657Transcription factor LUX
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.88301e-180floral bud| pod
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj4g3v1153140.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0044890.0AP004489.1 Lotus japonicus genomic DNA, chromosome 2, clone: LjT04I02, TM0021, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028245394.10.0two-component response regulator-like APRR2
RefseqXP_028245402.10.0two-component response regulator-like APRR2
SwissprotQ6LA431e-135APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A445M5R90.0A0A445M5R9_GLYSO; Two-component response regulator-like APRR2 isoform A
STRINGGLYMA01G40900.40.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35663465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-132ARR-B family protein
Publications ? help Back to Top
  1. Gong L, et al.
    Transcriptome Profiling of the Potato (Solanum tuberosum L.) Plant under Drought Stress and Water-Stimulus Conditions.
    PLoS ONE, 2015. 10(5): p. e0128041
    [PMID:26010543]