PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v1010080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GATA
Protein Properties Length: 322aa    MW: 35448.6 Da    PI: 6.1837
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v1010080.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA581.3e-18237271135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  Lj4g3v1010080.1 237 CSHCGVQKTPQWRTGPLGAKTLCNACGVRFKSGRL 271
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.5E-867314IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.308231267IPR000679Zinc finger, GATA-type
SMARTSM004017.0E-16231285IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.65E-14233293No hitNo description
Gene3DG3DSA:3.30.50.101.4E-14235269IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.38E-13236284No hitNo description
PfamPF003201.8E-16237271IPR000679Zinc finger, GATA-type
PROSITE patternPS003440237262IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MECVEAALKS SFRKDTALKL SSQTFLEELS AFNVQNVVTS CDDFVVDDLL DFSHEEELFE  60
EEPEQHHHGS VSEKQNETQE ICNPSSFNDQ FPSLPTSELS VPDDDAANLE WLSHFVEESF  120
SEHTVSLPTG VSTESGGEKE AEPGSQVRPC FRTPVPAKAR SKRTRTGVRV WPVVSPSFPE  180
LSSSTSSSTT TTTTATPCSP SLSSPSSPVF VCPAVSFERG WLPPEKKAKV RRPPRRCSHC  240
GVQKTPQWRT GPLGAKTLCN ACGVRFKSGR LLPEYRPACS PTFSSQLHSN HHRKVLEMRR  300
KKEEVMGEPV TGSGLPPVDP GF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007204696.11e-101hypothetical protein PRUPE_ppa008278mg
SwissprotQ9FH571e-78GATA5_ARATH; GATA transcription factor 5
TrEMBLM5WGI31e-101M5WGI3_PRUPE; Uncharacterized protein
STRINGGLYMA01G37450.18e-95(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.12e-47GATA transcription factor 7