PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v0911380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 792aa    MW: 87096 Da    PI: 6.6636
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v0911380.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33e-095726091954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yps +++  LA+k+gL+ +qV++WF N R +
  Lj4g3v0911380.1 572 FEHflHPYPSDADKHLLARKTGLSRNQVSNWFINARVR 609
                      664459******************************88 PP

2BELL114.36.3e-37432503172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      +r e+q++k+kLl++l+eVd+r ++y+eq+q+v++sF+ v+g g+a pYtslA+ka+SrhFrcLkdai  q+
  Lj4g3v0911380.1 432 DRIEHQRRKVKLLTMLDEVDRRSSHYCEQMQMVVNSFDLVMGFGAAVPYTSLAQKAMSRHFRCLKDAILAQL 503
                      589*****************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.1E-71369501IPR006563POX domain
PfamPF075261.4E-48374499IPR006563POX domain
PROSITE profilePS5007112.487550613IPR001356Homeobox domain
SMARTSM003892.4E-9553617IPR001356Homeobox domain
CDDcd000868.93E-13553614No hitNo description
SuperFamilySSF466899.84E-17555620IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-28556619IPR009057Homeodomain-like
PfamPF059206.8E-18570609IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 792 aa     Download sequence    Send to blast
MAIATPSTLP STLSQSKTNN YHSFDSILDK QQDSSDNSMS QDYHQGIFTF SNGFERSTTE  60
HQQHQHSQIH RDKVRVQDFD PQPPPPPPLV AIEDEPGGIP VYETTGMLSE MFNFPSGAPA  120
GGELLEQQPQ QQSMTVAFRS SPRPQAVGSS DWYGNNRQGM LTGSGPLEDS KIPHHHLQHQ  180
SSVNSRDTSS IVQHHSNQHH HHHMSNINAD SAAAMQLFLM NPQTRSPSPP PPHQHNNNQT  240
TPSTLHMLLP NPSSTFGSGG SFSQFTWVPG STQEPGANNP TENIAGVVEG QGLSLSLSSH  300
LEAAKAEELR MGDSGNFLYN YNNQGGAGSS SSPHYPYNKN NLGVQLQHHN HQALHMQGGF  360
VTPSSSSSLG VVNVLRNSKY VKAAQELLEE FCSVGRGQFK KNKFTRQLSN PSSNPGASSS  420
SSKDAPHLSP ADRIEHQRRK VKLLTMLDEV DRRSSHYCEQ MQMVVNSFDL VMGFGAAVPY  480
TSLAQKAMSR HFRCLKDAIL AQLKHSCELL GEKDGAGSSG LTKGETPRLK MLEQSLRQQR  540
AFHQMGMMEQ EAWRPQRGLP ERSVNILRAW LFEHFLHPYP SDADKHLLAR KTGLSRNQVS  600
NWFINARVRL WKPMVEDMYQ QELKEAEGAA EAEAAAEEEE EERERERNHQ SSSSSSGHHH  660
HLVQTPTPSA TTPPPPTFQS ENDPSVLNAI NRQGFLENHE YSNATTTTVT VAPPVSDSDV  720
HPANTADDTC RHGSFGTEDY GTASAASDNI GSALIRFGTT TVGDVSLTLG LRHAGNVPPE  780
KSPFSLRDFG AI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16559616562Homeobox protein Meis2
3k2a_B3e-16559616562Homeobox protein Meis2
4xrm_A3e-16559616562Homeobox protein Meis2
4xrm_B3e-16559616562Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.107480.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003629527.20.0BEL1-related homeotic protein
SwissprotQ94KL51e-159BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLG7LFL60.0G7LFL6_MEDTR; BEL1-related homeotic protein
STRINGGLYMA02G06730.10.0(Glycine max)
STRINGPOPTR_0007s12170.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35243257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-142BEL1-like homeodomain 2