PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v0668260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family ARR-B
Protein Properties Length: 363aa    MW: 40145.6 Da    PI: 7.0247
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v0668260.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.61.1e-26201254155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+rl+Wt +LH++Fv av+qL G ekA+Pk+il lm+v+gL+ +hv+SHLQk++l
  Lj4g3v0668260.1 201 KARLVWTADLHSKFVAAVQQL-GFEKAVPKRILALMNVEGLSKHHVASHLQKFKL 254
                      68*******************.9******************************87 PP

2Response_reg63.69.9e-22251341109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vd +++ +++l+++l++ +y +v++++++  ale+l++++  +Dl++  ++ p+mdG++llk+i  e +++p+i+++ h+++e++  ++  
  Lj4g3v0668260.1  25 VLAVDGDQACLRVLENLLRQCNY-NVTTTTHSIMALEILRRNRnnFDLLISALNKPDMDGFQLLKQIGLEMMDIPVIMLSEHSDKELVMSCVTH 117
                      799********************.***************888888**********************99999********************** PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga  +  Kp+ +ee+ +
  Lj4g3v0668260.1 118 GACNYMLKPVRMEEMKN 134
                      *************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363924.0E-1166361IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.4E-3422148No hitNo description
SuperFamilySSF521721.08E-2922145IPR011006CheY-like superfamily
SMARTSM004483.4E-2223136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011035.73324140IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.0E-1825134IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.88E-2126139No hitNo description
PROSITE profilePS512949.027198257IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-26199258IPR009057Homeodomain-like
SuperFamilySSF466891.24E-16199258IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-23201254IPR006447Myb domain, plants
PfamPF002499.2E-7204252IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MNVTVSNPLV SHDVAGDHFP VGMRVLAVDG DQACLRVLEN LLRQCNYNVT TTTHSIMALE  60
ILRRNRNNFD LLISALNKPD MDGFQLLKQI GLEMMDIPVI MLSEHSDKEL VMSCVTHGAC  120
NYMLKPVRME EMKNIWQHVV RRKMIGCSDQ NLAVNNEKTC NVAGEGSSHG GTVSENRGQK  180
RKELSEDEKV KGDDEQSSRK KARLVWTADL HSKFVAAVQQ LGFEKAVPKR ILALMNVEGL  240
SKHHVASHLQ KFKLGLKKSH NPASLNLGGS SGSYPLVKPI QSANHSSNSI FHYNATQLSN  300
FSEDLSPLSE VNDDQLADQS LKFCSSGSGD FSATSGVADP IQNARADGMQ SSFWEQILLW  360
ESI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-18197258162ARR10-B
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected immediately after seed germination. {ECO:0000269|PubMed:17363254}.
UniprotTISSUE SPECIFICITY: Detected in the whole plant. Predominantly expressed in leaves. Expressed at the root transition zone (PubMed:17363254). {ECO:0000269|PubMed:15173562, ECO:0000269|PubMed:17363254}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the root-meristem size determination through the regulation of cell differentiation (PubMed:17363254). Involved in activating SHY2 during meristem growth and controls PIN expression via activation of SHY2 (PubMed:20605455). {ECO:0000250|UniProtKB:Q940D0, ECO:0000269|PubMed:17363254, ECO:0000269|PubMed:20605455}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj4g3v0668260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0061310.0AP006131.1 Lotus japonicus genomic DNA, chromosome 4, clone: LjT28E04, TM0229, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027368781.11e-104two-component response regulator ARR12-like
SwissprotP625982e-84ARR12_ARATH; Two-component response regulator ARR12
TrEMBLA0A371FAN09e-97A0A371FAN0_MUCPR; Two-component response regulator
STRINGGLYMA15G24770.18e-95(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1744167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.19e-87response regulator 12
Publications ? help Back to Top
  1. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  2. Cortleven A, et al.
    A novel protective function for cytokinin in the light stress response is mediated by the Arabidopsis histidine kinase2 and Arabidopsis histidine kinase3 receptors.
    Plant Physiol., 2014. 164(3): p. 1470-83
    [PMID:24424319]
  3. Kim HJ,Kieber JJ,Schaller GE
    The rice F-box protein KISS ME DEADLY2 functions as a negative regulator of cytokinin signalling.
    Plant Signal Behav, 2013. 8(12): p. e26434
    [PMID:24675172]
  4. Choi SH, et al.
    Gene duplication of type-B ARR transcription factors systematically extends transcriptional regulatory structures in Arabidopsis.
    Sci Rep, 2014. 4: p. 7197
    [PMID:25425016]
  5. Jiang L, et al.
    Strigolactones spatially influence lateral root development through the cytokinin signaling network.
    J. Exp. Bot., 2016. 67(1): p. 379-89
    [PMID:26519957]
  6. Cortleven A, et al.
    Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes.
    Plant Physiol., 2016. 172(1): p. 464-78
    [PMID:27388681]
  7. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  8. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  9. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  10. Kobayashi K,Iwase A
    Simultaneous but spatially different regulation of non-photosynthetic callus formation and photosynthetic root development after shoot removal.
    Plant Signal Behav, 2017. 12(6): p. e1338999
    [PMID:28594268]
  11. Dai X, et al.
    ARR12 promotes de novo shoot regeneration in Arabidopsis thaliana via activation of WUSCHEL expression.
    J Integr Plant Biol, 2017. 59(10): p. 747-758
    [PMID:28681564]
  12. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  13. Yan Z, et al.
    Type B Response Regulators Act As Central Integrators in Transcriptional Control of the Auxin Biosynthesis Enzyme TAA1.
    Plant Physiol., 2017. 175(3): p. 1438-1454
    [PMID:28931628]
  14. Bustillo-AvendaƱo E, et al.
    Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis.
    Plant Physiol., 2018. 176(2): p. 1709-1727
    [PMID:29233938]