PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v0571920.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 324aa    MW: 36598.6 Da    PI: 9.4418
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v0571920.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.64.4e-31262316156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+peLH+rFv+a+++LGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Lj4g3v0571920.2 262 KQRRCWSPELHRRFVNALQKLGGSQ-ATPKQIRELMQVDGLTNDEVKSHLQKYRLH 316
                      79*******************9987.****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.392259318IPR017930Myb domain
SuperFamilySSF466893.94E-18260318IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-29260317IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-27262316IPR006447Myb domain, plants
PfamPF002492.4E-8264314IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGSVPAELSL DLRPSFVPKT VANFLYELST IPRSTDKLSR LHDFLARLED ELRKIDAFKR  60
ELPLCMLLLN DAILVLKEES EKCRAHNSPP VLEEFIPLKK EHDQSEENDS KENECRDKKN  120
WMSSVQLWNN TTPRKACDQI PIQHLNYKLD TKKNEEGNSV VAEDPFQSCN VKNGGSAFLP  180
FSTYSSIPVT TVALQAAKEE KEDTVLNRLS LLTPGVKSLR EGFGSRGSRS SSSSRAVSSS  240
SPPIVPPSLR AGSLQQQQNA RKQRRCWSPE LHRRFVNALQ KLGGSQATPK QIRELMQVDG  300
LTNDEVKSHL QKYRLHRQPL ISRV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.225410.0pod
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj4g3v0571920.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1443991e-118BT144399.1 Lotus japonicus clone JCVI-FLLj-20H9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004505183.21e-146myb family transcription factor EFM isoform X2
TrEMBLA0A1S2YIW91e-145A0A1S2YIW9_CICAR; myb family transcription factor EFM isoform X2
STRINGXP_007156531.11e-122(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.15e-56G2-like family protein