PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v0281180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 342aa    MW: 37921.4 Da    PI: 6.9983
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v0281180.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.84.6e-33176233259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp++v++tYeg+Hnh+
  Lj4g3v0281180.1 176 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCTVKKRVERSYQDPTTVITTYEGQHNHP 233
                      8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-34160235IPR003657WRKY domain
SuperFamilySSF1182902.35E-29167235IPR003657WRKY domain
PROSITE profilePS5081133.029170235IPR003657WRKY domain
SMARTSM007745.9E-38175234IPR003657WRKY domain
PfamPF031061.3E-25176233IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MSDEHQDLVP GGGSNMYSEL KHHISNSFPS AYHHDSSSQA FDDPPNYMSF TECLQGRVMD  60
YNYSPFGNTS FGLSPSSSEA FSSVDQGNQK PPEGDVAGGG GGGGETLATT TLNSSISASS  120
SSDAGAEEDS GKKKKDNNQV KEEGNNSGNK DKKKGEKKQK EPRFAFMTKS EVDHLEDGYR  180
WRKYGQKAVK NSPYPRSYYR CTTQKCTVKK RVERSYQDPT TVITTYEGQH NHPVPTSLRG  240
NAAGMFTHHY SLLTTPPTPP LSLTAGSNFP QDLFLHHHMQ NQTLIFNNNN NNNNAPSSTN  300
SSMYSHYNNN SLLQHQHQHQ LPPDQYGLLQ DIVPSMFLKQ EP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-28165235777Probable WRKY transcription factor 4
2lex_A2e-28165235777Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.152790.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj4g3v0281180.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027347511.11e-105WRKY transcription factor 28-like
TrEMBLA0A072UZW87e-99A0A072UZW8_MEDTR; Putative transcription factor WRKY family
STRINGGLYMA05G25770.12e-96(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22313483
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.12e-55WRKY DNA-binding protein 28