PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v3747740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 359aa    MW: 41654.4 Da    PI: 6.5133
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v3747740.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1791.2e-5571361129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeelv++yL+kkv+++k++l +vik+vd+yk+ePwdL++  ++   e+++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk+
  Lj3g3v3747740.1   7 VPPGFRFHPTDEELVDYYLRKKVASRKIDL-DVIKDVDLYKIEPWDLQEicRIGReEQSDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKA 99 
                      69****************************.9***************954544442555*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      ++s k+ l+g++ktLvfykgrap+g+k+dW+mheyrle
  Lj3g3v3747740.1 100 IYS-KHDLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                      ***.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.29E-615156IPR003441NAC domain
PROSITE profilePS5100559.8557156IPR003441NAC domain
PfamPF023657.1E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MNAFSHVPPG FRFHPTDEEL VDYYLRKKVA SRKIDLDVIK DVDLYKIEPW DLQEICRIGR  60
EEQSDWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YSKHDLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN ATPQEEGWVV CRVFKKRVAA TSMRRVSEHA SPCWYDDQVS  180
FMPDLDSPKQ TSQSNMNLVY QQLPYNNNPC KKELEFPYQL PREHFLQLPF LESPKIQLQS  240
SSTMEPFGGS HATTLLQEEQ VQLQTGHQQN FQAMMYGNNN NNTNNIEEQV TDWRVLDKFV  300
ASQLSQDDHA ASNSKDNNNS YSSNTAPANM FHSTDNNNGA LQFTHLDKQD MVPENAAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A8e-50716020172NAC domain-containing protein 19
3swm_B8e-50716020172NAC domain-containing protein 19
3swm_C8e-50716020172NAC domain-containing protein 19
3swm_D8e-50716020172NAC domain-containing protein 19
3swp_A8e-50716020172NAC domain-containing protein 19
3swp_B8e-50716020172NAC domain-containing protein 19
3swp_C8e-50716020172NAC domain-containing protein 19
3swp_D8e-50716020172NAC domain-containing protein 19
3ulx_A7e-50615714169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Expressed in root, shoot and hypocotyl vascular elements, columella root caps, epidermal and cortex root cells and root-hypocotyl junctions. Observed predominantly in root imature xylem vessels (PubMed:18445131). Present in root developing xylems (PubMed:16103214, PubMed:17565617). Specifically expressed in vessels in the secondary xylem of the root-hypocotyl region, and in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj3g3v3747740.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027356044.10.0NAC domain-containing protein 7-like
SwissprotQ9FWX21e-138NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A445J4Z51e-179A0A445J4Z5_GLYSO; NAC domain-containing protein 7
TrEMBLI1L5Q51e-179I1L5Q5_SOYBN; Uncharacterized protein
STRINGGLYMA09G36600.11e-180(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-124NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]