PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v3386580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GATA
Protein Properties Length: 303aa    MW: 33838.7 Da    PI: 5.1769
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v3386580.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.73.7e-19220253134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      Cs+C++ kTp+WR gp g+ktLCnaCG+++++ +
  Lj3g3v3386580.1 220 CSHCQVQKTPQWRAGPLGPKTLCNACGVRFKSGR 253
                      *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169925.6E-8113302IPR016679Transcription factor, GATA, plant
SMARTSM004015.5E-14214268IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.068214250IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.18E-14217277No hitNo description
Gene3DG3DSA:3.30.50.101.5E-14218251IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.51E-15219276No hitNo description
PfamPF003207.1E-17220253IPR000679Zinc finger, GATA-type
PROSITE patternPS003440220245IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MEVAVAKALK PSLQTEFVFS QEIRNEILCL NANNVVVGED FSVDDLLDFS NGKEMDDYEE  60
EEEEEEEEKG STVSGGSQDR IEEDSNSNST AAGDYDSIFA GELAVPADDV AGLEWVSHFV  120
DDSLPELSLL YPVRAEQTRA RAEPEARPGS DRAPFPFRTK PRTTRTRKPI GHVWSFNPMG  180
FSSMAPPLSG EGFRQPPMKK QKKKPEAQDH TGGPQFQRRC SHCQVQKTPQ WRAGPLGPKT  240
LCNACGVRFK SGRLFPEYRP ACSPTFSGEI HSNSHRKVLE MRRRKETAEP VSGLDQARMV  300
QSF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.43450.0cell culture| pod| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003607047.11e-134GATA type zinc finger transcription factor family protein
RefseqXP_013456438.11e-134GATA type zinc finger transcription factor family protein
TrEMBLA0A151RII01e-135A0A151RII0_CAJCA; GATA transcription factor 12
STRINGGLYMA12G04180.21e-124(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.13e-47GATA transcription factor 7